SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G08350.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G08350.1
Domain Number 1 Region: 680-968
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-72
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 122-247,344-573
Classification Level Classification E-value
Superfamily RNI-like 2.12e-67
Family Rna1p (RanGAP1), N-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 206-347
Classification Level Classification E-value
Superfamily L domain-like 1.6e-24
Family Polygalacturonase inhibiting protein PGIP 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G08350.1   Gene: BRADI2G08350   Transcript: BRADI2G08350.1
Sequence length 1000
Comment pep:novel chromosome:Brachy1.0:2:6739873:6743571:1 gene:BRADI2G08350 transcript:BRADI2G08350.1
Sequence
MGAFLPILLLAAVAANAGLLLAQALNQDGLYLLDAKRALTVPAGALADWNSRDATPCNWT
GVSCDAAGAVTGLSLPGANINGSFPAALCRVPRLQSLDLSNNYIGPDMASEAVAGCKALA
RLDLSVNSLVGTLPGALAGLPELVYLNLEGNNFSGPIPDSFGRFPKLESLSLVYNLLGGE
VPSFFGAVPTLRELNLSYNPFAPGPVPAELGDLAALRVLWLAGCNLVGHIPASLGRLRNL
TDLDLSTNALTGPIPPEITGLASAVQIELYNNSLSGAIPKGFGKLAELRSIDIAMNRLDG
AIPDDLFDAPKLETVHLYSNSLTGPVPESAAKAPSLVELRLFTNRLNGTLPSDLGKNTPL
VCLDLSDNSISGEIPRGICDRGELEELLMLDNALTGRIPEGLGRCHRLRRVRLSNNRLDG
DVPGAVWGLPHIALLELNGNRLTGEISPVIAGAANLSKLVISNNRLSGSIPSEIGSAAKL
YEFSADGNMLSGPLPSSLGSLAELGRLVLRNNSLSGQLLRGFHSWKKLSELNLADNSFTG
GIPPELGDLPVLNYLDLSGNRLSGEVPIQLENLKLNQFNVSNNQLSGQLPPQYATEAYRS
SFVGNPGLCGEITGLCATSQGRTGNHSGFVWMMRSIFIFAAVVLVAGIAWFYWRYRTFNK
ARLSADRSKWTLTSFHKLSFSEYDILDCLDEDNVIGSGASGKVYKAVLGNGEIVAVKKLW
GGALKKDMENSGEGSAADNSFEAEVRTLGKIRHKNIVKLLCCCTHNDCKLLVYEYMPNGS
LGDVLHSSKAGLLDWPTRYKVALDAAEGLSYLHQDCVPAIVHRDVKSNNILLDAEFGACV
ADFGVAKVLEATDRAPKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVLLELVTGKP
PVDPEFGEKDLVKWVCSTIDQKGVEPVLDSKLDMTFKEEISRVLNIGLMCASSLPINRPA
MRRVVKMLQEVRAEERQRLEKDGKLSPYYYEDSSDQGSSV
Download sequence
Identical sequences I1HDR5
XP_003566237.1.954 EG:BRADI2G08350.1 15368.BRADI2G08350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]