SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G08750.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G08750.1
Domain Number 1 Region: 740-1024
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-70
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 327-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000423
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G08750.1
Domain Number - Region: 628-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00692
Family Laminin-type module 0.075
Further Details:      
 
Domain Number - Region: 298-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0453
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G08750.1   Gene: BRADI2G08750   Transcript: BRADI2G08750.1
Sequence length 1082
Comment pep:novel chromosome:Brachy1.0:2:7096053:7100155:1 gene:BRADI2G08750 transcript:BRADI2G08750.1
Sequence
MASLSMAATSTTASMALALLLMVVSSALAAPADPAPAIGLPGCDTACGDVGVPYPFGMGP
ARCYRSPGFNLTCDRSSNPPRLLLGNDGTLQVLCIDLSEPSVLVNRYRTAGDIKVGPDGR
GSFGGGLGDDGPYALSPGSFGNGNELIVTGCNVRATLKDGNNVTMSGCSSLCQDGRDGRP
SQYAWSRLDSSMLCTGISCCQAPIVVNLEKVKGRPPVYSASYHVELEWFGSNRSADEERM
PARVFVAKEGWFENKQVFRTLLNSDFTETLEVPVWLDWEVDVGGHGGGAAAAAAADRNIR
CSDGTRGGYICLCKTGYQGSPYITQGCKDIDECKLPQYWCLGDAVCTNTDGDYDCGCPPG
THGNATLPGGWVPSVTATGDICNSTCGNVVVPYPFGMGPSHCYRPGFNLTCNYPSSGSKP
PRLLLDSHGAFQVVDISLKNTTVRVVTAAPPIEVTTKNQYSFHFDDDLTDRGQALFSLST
RNELILKGCNVQATLLGRWQGRGREHDGTIISGCATFCSDNASAPDDGTRTMQDSPDDKN
CYGMGCCQARIATSMDGMPRLLSFKFTDLNNVQDNLTALPPYVLIAEEGWFDKGLVSHQQ
LQALQRKSSFKPEVPIVLHWEVMQQGSGLPRADMNNCPMEVDSRLCKSKHSHCIPGNRGY
SCQCDDGYRGNPYLVEGGCTGISVVIGIASGVGPLLSVLIAFFVSNKIKERRARLLKRKF
FEQNRGQLFEQLVSQRTDIAEKMIITLDELAKATNNFDKSRELGGGGHGTVYKGILSDLH
VVAIKKPKKMAQKEIDGFINEVAILSQINHRNVVKLYGCCLETEVPMLVYEFISNGTLYE
HLHIDRPRSLAWDYSLRIATETAKSLAYLHSTASMPIIHRDVKSANILLDDMLTAKVADF
GASRYIPKDKSEVTTRAQGTRGYWDPMCIYTGRVTEKSDVYSFGVVLIELLTRQKPSSYL
SSEGEALVVHFVNLFAESNLIKILDPQVMEEGGKEVEGVAAIAAACTKLRGEDRPTMRQV
ELTLEGYCASKEHILDNALAKKVKKNDTAAYCSSTKLKRSSEGSTIPYSMEKEFILSASY
PR
Download sequence
Identical sequences I1HDW2
15368.BRADI2G08750.1 EG:BRADI2G08750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]