SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G09370.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G09370.1
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-81
Family Protein kinases, catalytic subunit 0.0000601
Further Details:      
 
Domain Number 2 Region: 550-903,931-975,1007-1039
Classification Level Classification E-value
Superfamily ARM repeat 3.46e-18
Family HspBP1 domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G09370.1   Gene: BRADI2G09370   Transcript: BRADI2G09370.1
Sequence length 1349
Comment pep:novel chromosome:Brachy1.0:2:7661686:7669186:-1 gene:BRADI2G09370 transcript:BRADI2G09370.1
Sequence
MNNFHVYEAIGRGKHSTVYKGRKKKTIEYFAVKSVDKSQRSKVLNEVRMLHSLDHANVLK
FYSWYETSAHFWLVLEYCVGGDLKGLLEQDEKLPESAMHDLAYDLVKALLFLHSQGIIYC
DLKPSNILLDEFGCMKLCDFGLARRLKDIEKTTPGDVPQPMRGTPCYMAPELFREGGVHS
YASDFWALGCVLYECYAGKPPFVGSEFTQLVKSILSDPTPLLPDNPSRSFQNLINCLLMK
DPAERLQWSELCEHNFWRSSMPLIPLPPQPAFDKMVGLSSTPYLAERNGDKLSRQLTPPK
TREYNGLRKKDENSGQGFTTPVKNVQSSKKNSAKPSCKADGGLKGVNVLRMSRIAKINLQ
RERDKENYRRGPTDTYENEAKVKIENNDMELDFGENPEGDAPDDNDGSDNTASTADEKQM
AQGADGNEENCMINQMDMLTDECSVKPDTVQKTEQNCSEVLDVVATPPSFGMRKARAKIT
SGAATGSEPLNIFEAFWHPADLAVKPVMPSKKGDKATEVVPVLPFEALPAGDYIKLPREQ
MNAFNSQIIQSLSGTFQVSEKQNIIRYLEMLSMNSDAANIITNGPIMSLLIKMLRLSKTS
VLRVQVASLMGLLIRYSTILDAELASSGIVNALSDGLRDRHDKLRRSCMATLGELLFYIS
TQSDEDNKESNAQESPLKDNKSAASWQVPSAVIALVSSILRKGEDDLAQLYALRTIDNIC
SQGTDWTSRFASQDVIGHLCYIYKATGKQENTRLIAVSCLSRLARFSSSCIHLILEKLSF
KDMACTLIKGNPREQQTTLNLLNSALVNSHNIANMNRYILSLTEEKQLVPGLISLIEQGT
DVLRGKALLFVALLCKNSRRWLPHFFCNAKLLSAVDRLGKEKVGFIHQCMEAFVQLVASL
VPGILDTVCSDIQQVMGGKRHGPVTALTGRSHPKSTIHLFPVILHLLGSVSFNHRVVTSH
VLLQLANLMKILETPFQARDDFQMTLLRVLEAATEEPSVILKEHKIFTTRFLPSLSILYK
GNKDCDARFLCLKILSDVMIVIFSDSSLTADERTVADLKTISHKYFLPMYPSFAEDEDPI
PIYAQKLLVMLMEHDCVKVSDILNEATVSQCFEFLLGDLSNANVSNVKLCFALASAPDMD
TNILSQLQVVRRIGNLLEFVTAKDMDDFLEPTLELCRAFIIRGIGSNRSIALTKEPALLV
DSAFSMSIAVDQQSCIMDICDLGGSMGIFLEVVGNSDPQISDLASDCLVLLLKAAPREAT
MGLLTNLPKLSTVLDVLKNDACLRLTRLLYGLAFSCRQYLAQGMILSISVPALMRVEALV
LAFKGAHDSRLVDAASYLGAELQRLPRCG
Download sequence
Identical sequences I1HE38
XP_014755217.1.954 EG:BRADI2G09370.1 15368.BRADI2G09370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]