SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G10692.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G10692.1
Domain Number 1 Region: 495-783
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-75
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 65-166,198-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-24
Family alpha-D-mannose-specific plant lectins 0.0079
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G10692.1
Domain Number - Region: 381-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00049
Family Pan module (APPLE domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G10692.1   Gene: BRADI2G10692   Transcript: BRADI2G10692.1
Sequence length 814
Comment pep:novel chromosome:Brachy1.0:2:8897023:8899722:-1 gene:BRADI2G10692 transcript:BRADI2G10692.1
Sequence
MALLLSTLAVLLLVSLAPTRAASASTATISAGQVLAADDTLVSNNSKFVLGFFQGESSAR
NSSKWYLGIWFSAIPTRTTVWVADGASPIMDAGATPQLAISDNGSLAVSNRATNSITWST
HNTQPQSPTNMNKTVGVLLNTGNLVLQDTSDSQPRVLWQSFDYPTDTLLPSAKLGRDKVT
GLNRRLVSKKSLAGPTPGRYCYEVDPDTPQMVLKLCNSSIVYWSTGPWNGRAFSGIPELT
GDSPNFHLAFVDNSREEYLQYNVTIEVVTRSMLDVTGQNIHQVWRDSGSAQGQGWQTLYA
APKSPCDVYGVCGPFALCDYDLLPVCVCMKGFSARSLRDWEQGDRTGGCVRDTPLNCNSS
RRAASTDDKFYSSMASVTLPDKSQSMQAARSLAECSQACLNNCSCTAYSYGSQGCLVWQD
ELLNAKTNAGTRVSANGAGTLYLRLAASEIPRPSTGSSKTGLIVGVVLGASAALVLVFVA
LIMWRRKTKTSAQGGGLVAFSYKDLRSASKNFSEKLGQGGFGSVFKGQLRDSTSIAVKRL
DGSFQGDKQFRAEVSSIGIIQHINLVKLVGFCCDGDSRFLVYEHMPNRSLDIHLFQSGGT
LLNWSTRYQIALGVARGLSYLHEGCRDCIIHCDIKPQNILLDASLRPKIADFGMAKLVGR
DFSRVLTTMRGTLGYLAPEWISGTPITAKVDVYSYGMVLLELVSGRRNTDEEYTASDGSH
VVYFPMQASKKLLEGDVMSLLDQRLGGDANLKEVQRVCKVACWCIQDEEAQRPTMGQVVQ
ILEGVLDREMPPLPRLIETIFARPRSANFSTETV
Download sequence
Identical sequences I1HEJ3
EG:BRADI2G10692.1 XP_003567223.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]