SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G11220.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G11220.1
Domain Number 1 Region: 14-282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-95
Family Protein kinases, catalytic subunit 0.00000755
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G11220.1
Domain Number - Region: 339-430
Classification Level Classification E-value
Superfamily KA1-like 0.0177
Family Kinase associated domain 1, KA1 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G11220.1   Gene: BRADI2G11220   Transcript: BRADI2G11220.1
Sequence length 459
Comment pep:novel chromosome:Brachy1.0:2:9472227:9477203:1 gene:BRADI2G11220 transcript:BRADI2G11220.1
Sequence
MVNGEEECTRASLLGRYEIGRTLGEGNFGKVKYARHLATGAHFAVKILDRNKILSLRFDD
QIRREIGTLKLLKHPNVVRLHEVAASKTKIYMVLEYVNGGELFDKIAIKGKLSEHEGRRL
FQQLIDGVAYCHDKGVYHRDLKPENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGS
PNYIAPEVLQNRGYDGSLSDIWSCGVVLYVMLVGYLPFDDRNLVVLYQKIFKGDTQIPKW
LSPAAQDLLRKILEPNPMKRMNIKEIKEHEWFQKDYIPVVPYDDDEDVNPDSVLPMKEQI
DEAGQEKPTHINAFQLIGMASSLDLSGFFEEEDVSQRKIRFTSTHSPKDLFEKIENAVTV
MGFQAQRGHSKLKVMKKCKNSKNPQNPSPFLACAEVFELGPSLYVVELKKSHGEPLLYRQ
LCEKLSDELGVCKTEQIPRTESLDSDLASFDDGSPLSGF
Download sequence
Identical sequences I1HEQ3
XP_003567562.1.954 15368.BRADI2G11220.1 EG:BRADI2G11220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]