SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G11807.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G11807.1
Domain Number 1 Region: 395-580,623-669
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.83e-40
Family Phospholipase D 0.043
Further Details:      
 
Domain Number 2 Region: 805-1060
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.1e-28
Family Polyphosphate kinase C-terminal domain 0.093
Further Details:      
 
Domain Number 3 Region: 322-415
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000263
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G11807.1   Gene: BRADI2G11807   Transcript: BRADI2G11807.1
Sequence length 1191
Comment pep:novel chromosome:Brachy1.0:2:10122531:10138616:-1 gene:BRADI2G11807 transcript:BRADI2G11807.1
Sequence
MHFRVLLNPDLQVGVDQKSKANPKFGRHAALPPLCLPPVTSFHQTALPIRVPRSAPSNPI
PGPPYKNTKRKLQSESMSWEQPEEEEEHRYVRMPPEGEATASSSSSFRLPESARVFDELP
RARIIGVSRPDAGDITPIMLSYTIEVQYKQFRWLLYKKASQVLYLHFTLKRRAFLEEFHE
KQEQVKDWLQNLGIGEHMPVVHEDEEADDVHVPSQQDDHSVKNRNVPSSAVLPVIRPALG
RQQSISDRAKIAMQQYLNHFFGNLDIVNLREVCKFLEVSLLSFLPEYGPKLKEDYVTVRH
LPKIDTNSKERCCSSSCFSFCNSSWQKVWAVLKPGFLALFQDPFDPKLLDIVIFDVSPDM
HRNEEGQITLAKEIKESNPLHFGFEVSSGARTIKLRTGSSAKVKDWVTAINAARRLPEGW
CHPHRFGSFAPPRGLTEDGSIVQWFIDGQAAFNAIASSIEQAKSEIFITDWWLCPELYLR
RPFHYHGTSRLDILLESKAKQGVQIYILLYKEVSLALKINSMYSKRRLLNIHENVKVLRY
PDHFSTGIYLWSHHEKIVIVDNQICYIGGLDLCFGRYDTPEHKVVDSPSSIWPGKDYYNP
RESEPNSWEDTMKDELDRTKYPRMPWHDVQCALYGPACRDVARHFVQRWNYAKRNKAPNE
QAIPLLMPHHHMVIPHYMGKSKETTGEIESKQTRDQDIKIRRLSSLPTASSCQDIPLLLP
QDPDHQALPNGDLGLNDLDINHYLLDHPNKTDLKQSLSNRKAKQDLSLQDLQLKGFVDNL
GSPDISLVTHHDTSKPNVHHMDKEWWETQERGSQVSSVLDVGEVGPRTTCRCQVIRSVGP
WSAGTTQIEGSIHNAYFSLIEKAEHFVYIENQFFISGLSGDDTIKNRVLEALYRRILRAE
KEKKCFRVIIVIPLLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILKNLYDLVGSKA
HDYISFYGLRAHGRLGDGGPLVTNQIYVHSKLMIIDDRMTLIGSANINDRSLLGSRDSEI
GMIIEDKEVVSSTMDGRHWEAGKFSLSLRLSLWAEHLGLRAGEVSQIMDPVADLTYKNIW
MATAKANTAIYQDVFLCVPNDHIHSRSQFRQTLTLWKEKIGHTTIDLGVALEKTEILEED
GEPVVVGTDPMGRLQAVRGNLVSFPLEFLCQEDLRPFFSESEYYTSPQVFH
Download sequence
Identical sequences I1HEX3
XP_003567601.2.954 EG:BRADI2G11807.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]