SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G11830.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G11830.1
Domain Number 1 Region: 56-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.02e-83
Family Actin-fragmin kinase, catalytic domain 0.0045
Further Details:      
 
Domain Number 2 Region: 702-847
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-32
Family Dual specificity phosphatase-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G11830.1   Gene: BRADI2G11830   Transcript: BRADI2G11830.1
Sequence length 932
Comment pep:novel chromosome:Brachy1.0:2:10149708:10157163:1 gene:BRADI2G11830 transcript:BRADI2G11830.1
Sequence
MEQRGARQEEVEKEQEAPPIPPPKENQEERDFKISSRVVSLLFGGGEISTPAQTFEKWVS
LVRKRSGTFRPSGFPRRSSRIEVMPSGSFSLFSTTELSEQVVRAEPARKEENPLTFDQPP
ELSLWERLGNASALDIESSDFSWRMLSSLHHTEHSSSSEHSEDEMSKALEVTVNSGGVVF
FALFSSLGNNGLPKEEASVIKFAASKMATQAELLGYEFARLLGVHTPQARVVHNSSMEWQ
EIKHAAENARAVAVSNNDEIGEMTCSELLEALELSRCLLLMSYIHGSPLLESSKAFSSRQ
AACVTSSSLGRVLMLDLILRNEDRLPCRQLGWRGNPANLMISDRPSSPSMDRFEDSKNTP
ESSNPLISDIFQREKWFHSANGRLDSPDLDVMSGKADALINVRENAESTSGTFHIVAIDT
GVPRRPPAGRRVKDHERYPKVMELILNNSDYSSNILWEISGGKLGLPGPDEAITSADSCC
SLSDEDNAAAIHEFRVAFRAALRDLEGFHLFLLQLYQKLDGVLRVFSSIITKSSEESDHN
DIAISDFPSPGGSYSTPCPPSKQLNNELYGESGMLKSATKSSSAGSRGSSDSVSPMSRDS
WSNKHLKGSVDAPRSLRMTMKLRDFYKTPKVDLDPEFLKEIEHWNEAFKTDVIRFCQENN
FHSGFFDGTENNMVADAYELKVRLEHIIERIALVSDSANTERPSLVIDNLFIGGALAARS
KYTLQHLGITHILCLCSNEIGQSDTQFPDIFQYKNFSISDDDDANISDLFEEASGFIDQV
DHVGGKVLIHCFEGKSRSATVVLAYLMLRKGFTLSKAWNLLKKVHRRAQPNDGFAKALLA
LDRKLHGKVSMDWQQKRPEMKVCPICSKNVGLSTSSLKLHLQKAHKRLSQGSVDSAMTME
IQKSIQSLRISRGGSLSPSQKLAKAFADELSF
Download sequence
Identical sequences I1HEX5
EG:BRADI2G11830.1 15368.BRADI2G11830.1 XP_003567602.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]