SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G11900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G11900.1
Domain Number 1 Region: 288-518
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.58e-70
Family CAT-like 0.00000603
Further Details:      
 
Domain Number 2 Region: 104-192
Classification Level Classification E-value
Superfamily Single hybrid motif 2.75e-21
Family Biotinyl/lipoyl-carrier proteins and domains 0.00036
Further Details:      
 
Domain Number 3 Region: 213-254
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000144
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G11900.1   Gene: BRADI2G11900   Transcript: BRADI2G11900.1
Sequence length 521
Comment pep:novel chromosome:Brachy1.0:2:10208364:10212516:-1 gene:BRADI2G11900 transcript:BRADI2G11900.1
Sequence
MAWSRLASRSSRRPFPVLPRPTTPPPPPHPPVAPATPSPPLRRLLLPLSPLRFAAAAAAA
SSSSSSYVRLLDDDWRRAVGGRSRWFASDASAAPVPAGEAAELVDVPLAQTGEGIAECEL
LRWFVSEGDQVDEFQQLCEVQSDKATIEITSRFKGTVHQVHFAPGDIVKVGETLLKMIVG
DSQVVSHDSMASSPDVSLGMDSASPVGEGNAPHGTLSTPAVRHLVKQYGLNINDIQGTGK
DGRVLKEDVLNYAANKSLCQEKPSALKENVGQVELLEGGKSLLDAQCYEDKRVPLRGYQR
SMVKSMSLAAKVPHFHYLEEINCDALIKLKASFQKENKDHNIKHTFLPFLIKSLSMALSK
YPLLNSSFIEETNEVVFKGSHNIGVAMATAHGLVVPYIKKVQSLSILEITKELSRLHEIA
LHNKLSTEDIAGGTITLSNIGAIGGKFGSPVLNLPEVAIIALGRIQKLPRFDEGENVYAS
SIINVTVGADHRVVDGATVARFCNEWKSLVEKPELLLLHMR
Download sequence
Identical sequences I1HEY2
EG:BRADI2G11900.1 XP_003567605.1.954 15368.BRADI2G11900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]