SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G12247.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G12247.1
Domain Number 1 Region: 328-573
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-76
Family BEACH domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 1293-1388,1421-1643
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.14e-30
Family WD40-repeat 0.0076
Further Details:      
 
Domain Number 3 Region: 204-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-18
Family Protein kinases, catalytic subunit 0.003
Further Details:      
 
Domain Number 4 Region: 715-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000256
Family Protein kinases, catalytic subunit 0.0062
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G12247.1
Domain Number - Region: 778-1111
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family HEAT repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G12247.1   Gene: BRADI2G12247   Transcript: BRADI2G12247.1
Sequence length 1645
Comment pep:novel chromosome:Brachy1.0:2:10584903:10595059:-1 gene:BRADI2G12247 transcript:BRADI2G12247.1
Sequence
MARSPPVTAAMCPECLERRVRSDLAGSGLSFVHVISDSPLPFASSAVVQIASDGAEERNW
SQKTYDFVLVALNGGKTFVDTKKCEKTPLEQPIIYTDDNRCEVQTDSSSGIEYTEDFQNS
YSSNNQLLIVNTVTKLIPVYYSGRISISEIRELIASYMNLKVEENVISSLNLLCENKISG
SAGLDFLNFVGFSAFDDLHPSGCVRHPNILPVLGVVESSDCCYMLHPKAPYTLENIMHYS
PKALCSDWHIRFLMYQIISALAYLHDSGVHHGNLKPSTILMSDSLWPYLSISDIYHVRQN
WGFERPKGSTPSSCCVAEDCSSRPIHTSFDLLSSLDWSSHFKRWWAGELSNYEYLLVLNK
LAGRRWGDPAFHPVMPWVIDFTVRPDENSDIGWRDLTKSKWRLAKGDEQLDFTYSSSEVP
HHVSDECLSELAVCSYKARRLSKTILRSAVRSVYEPNEYPSSMQRLYQWTPDECIPDFYS
DPRIFVSLHSEMSDLALPSWVTSSEEFICLHRDALESDRVSQQLHHWIDITFGYKLDGEA
SVEAKNVMLPPSDPSRPKSIGRRQLFTTPHPKRHISTPHPSYHNKVESCARCQAKGSNST
TDVASNGFIPPDMLSQVDYLEEFEQATIFMELEHHLDPKYNYTDTSSCYCSSVKYPKSHI
SDQEMLQSDTVLSVVPDFDFGSYLECFECDNSSPMGYQELLPWKQKSCSVIEHHANDIFS
IGCMLAEIYLRRPLFDASLLAAYRETGMLPGALNELPVHVGVLVESCIQREWKRRPSSKH
LLDSPYFPPSVQAAYMFLAPLQLLCTSGDRLKYVAKLASEGTLKAMGEFSAEMCAPYCLP
FVSSSLSDVDTESGLCLLKEFLKCLSVQATKQLILHIIQKILQAPEYSHLKVSLLQDSFV
RELWKKLGKQTYIENVHPLVIANLCNSPNKIIASAASIVLIGSSEELGIPITIHQTILPL
IHYFGKGLCADGIETLVRIGGLLGESFTVKQILPLLRNVILSCIDSSKVIKPEPQHSWNS
FALIDGLSALEGLVSVLPVKAVLKELLQDQVCLHIKVLMLIHLDLRVIQVAATALVDLCL
RIGPDNTAIYVLPHLKELFAELAFYHESSAVSLPSEGLKISKGNKSEPIKMESRIDLMFL
LYPFLASYVGIEKLRECCSTWFLLEQSLQRLYNWKLEPFSEWSKTAENMKDPRSQSGNCI
PSEVFPTELLFNGAGLSVSQSEITKTGWNVAVSRQGSRLEHGTSSDNLCSSTSGNQPWFW
FPSPDSSWGTPDFLGRSSGLKDEFQWKIKASVLYSARAHPGALRSLAVHDDECTVFTGGV
GPGFTGSIQRWQLPNMNCTSGYYGHEEVVNSICILSTTGKVASCDGTIHVWNGQTGKLIA
AHTESSTSFPLQTASVEQANMLNQDALSGGILSNAFRGSLYTTMHYMSSEDKLVAGMGNG
SIRFIDISQDRKLHLWKSDSAEISFSSLVSAICSCGSDKPRTGRLVDSSSWIAAGLSSGY
CRLLDERSGKIIAVWRAHDGHITKLASPEDHLIVSSSLDKTLRIWDLRRKLETQSNIFRS
HSDGIFDFSVWGQDLVSVSRNKISLTSLFRPTSEIGHQQLVLQNLYSTDRGVKSKNMSVL
STISVLPLSRLFVVGTEDGFLKICH
Download sequence
Identical sequences I1HF26
EG:BRADI2G12247.1 XP_010230850.1.954 XP_014754672.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]