SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G12627.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G12627.1
Domain Number 1 Region: 49-393
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.08e-78
Family Actin-fragmin kinase, catalytic domain 0.0048
Further Details:      
 
Domain Number 2 Region: 650-797
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-34
Family Dual specificity phosphatase-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G12627.1   Gene: BRADI2G12627   Transcript: BRADI2G12627.1
Sequence length 859
Comment pep:novel chromosome:Brachy1.0:2:10966599:10973132:1 gene:BRADI2G12627 transcript:BRADI2G12627.1
Sequence
MEEGSIESGSFSRSSSFGGFEEWLASMRKRTGKFSSSSRGPQQKPGILAIESTISSDGLE
VGDSDSDVIDSDPCDQLPKTSLWDRLGRVSMMDIESSNFSWSSLSSLHHTKHSNTSMEPT
EDDTSRSFEVTVNSGGVVFIALFRISEKDGLSSKEAAAVIKIASSRMATQSERFGYELGK
WLGVRTPQGRVIHSSSCEWQQIKDAVENARCAAIAIGDELQEMICSEMQEALELSRCLFL
MNYVHGSPLLESRTPFNSREFAEKTAEALGRILILDLVLRNEDRLKCRPLGWRGNYDNLL
VTDKEAYANLDSLDDAHDSAIIRYKPEIIRSPQKQKQRRSVSISGSTGSDISDLVLGDSY
DPSEPEISSFRIIAIDSVVPRRPPAGKRAKDQESYPRLVELTLNNWYYSSNLLFEVSFGK
LGVRGPEEFDMSSDCNYHSPLSENDMVAIVNSFREGFRSALRDLQRFHIFLLTLYQKLDA
LLKIFFNLMYKGLNESDKADAGPSDSPSCLVEAHTDSNGAEVPRHMRRPSRTLSLSRDSF
DLSSPACRESFMIKNFKANGDASRGLRLTMKLREFNKYTKVDSELSKEIEQWNDMLRTDV
VKLCQDNSFNTGFFEGIDNSVAVDAYELKVRLEHLLERISLISDAASTERPSQITDYMYI
GGALAARSTYTLQHLGITHVLCLCANEIGQSESQKPCLFDYRNFSINDDENADISDVFQD
ASDFIDFVEHLHGKVLVHCFEGKSRSATVVLAYLMLRKNRTLLEAWNMLKKAHRRAHPND
GFAKVLLDLDKKLHGRNSMEWQQKRPSMKVCPICGKNAGLSSSSLKLHLQKAHRKISSGS
VDSAMTLEIQKAIEAMKTG
Download sequence
Identical sequences I1HF70
XP_003565743.1.954 EG:BRADI2G12627.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]