SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G13210.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G13210.1
Domain Number 1 Region: 174-321
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.000000000235
Family FtsH protease domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G13210.1   Gene: BRADI2G13210   Transcript: BRADI2G13210.1
Sequence length 340
Comment pep:novel chromosome:Brachy1.0:2:11646758:11651594:1 gene:BRADI2G13210 transcript:BRADI2G13210.1
Sequence
MRLGRPPCCCITQLQPAAARRRLRLLPARAANTSSKAASRRSAVLGQVDDELQKGNDEAA
LSLVRSSLGEGGGLRCFGAARQVPQRLYKLDELKLNGIDTSSFLSPVDRTLGSIERNFQI
AAVLGGLSVSAVFELSQFQVLFLFVGLLFVWSVDLIYFNGGVRNLVLDTVGHNLSQKYHN
RVIQHEAGHFLIAYLLGVLPKEYTITSLDTLMKQGSLNVQAGTAFVDFEFVEEINTGKLS
AMMLNKFSCIALAGVATEYLLYGYAEGGLADVNKLDGLFKSLGFTQNKADSQVRWAVLNT
VLILRRHEDARSKLAEAMSSGRSVGSCIEVIEENVNTEDI
Download sequence
Identical sequences I1HFF0
XP_003567712.1.954 EG:BRADI2G13210.1 15368.BRADI2G13210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]