SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G13460.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G13460.1
Domain Number 1 Region: 348-419
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000132
Family Protein kinases, catalytic subunit 0.007
Further Details:      
 
Domain Number 2 Region: 20-99
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000045
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G13460.1
Domain Number - Region: 212-272
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.002
Family Pan module (APPLE domain) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G13460.1   Gene: BRADI2G13460   Transcript: BRADI2G13460.1
Sequence length 456
Comment pep:novel chromosome:Brachy1.0:2:11933294:11935563:1 gene:BRADI2G13460 transcript:BRADI2G13460.1
Sequence
MASAQGKFVVGLFSSGRSGRFYLGIWYKNVPVQTVIWVGNRANPLSSAASAELRVSSDDG
NLELVGLSGPSAAPGVVWSSNLSSSATTATWSSSTAAIPPRRTYVETAAYRRVTSVLYHN
DTFTRMVLDLTGQTKQYIWVPASQSWQLFWAAPTGECDVYALCGPFGVCDPRSQSSCRCP
PGFAPTEQRDWELSDWSAGCRRRSPLGCASTDGFVLLPGVKLPDDSLNVGAAAKRSRAEC
ESACLNNCSCQAYYTFSFSGGCGLWHGDFRNLQQLYTDSGLSGPSGDLYLRLSESGLRDL
RGAERKKGRKIWWLVLLFIIFGGLGALALVAWRILVSRRRRLGSMDGTSLEVYSYRDLRA
ATKNFSERLGGGGFGSVYRGVLKKKDTQTQLAVKKLESLRQGEKQFRTEVSTLGRIQHDE
EAQRPTMAQVLQALEGVIHVDAPPVPRALQHLVSLT
Download sequence
Identical sequences I1HFI2
EG:BRADI2G13460.1 15368.BRADI2G13460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]