SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G14200.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G14200.1
Domain Number 1 Region: 111-225
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000174
Family Phosphotyrosine-binding domain (PTB) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G14200.1   Gene: BRADI2G14200   Transcript: BRADI2G14200.1
Sequence length 242
Comment pep:novel chromosome:Brachy1.0:2:12829743:12832583:1 gene:BRADI2G14200 transcript:BRADI2G14200.1
Sequence
MDDVYGRIDIFPQHFLPPKESMEAADVMSTSKNNLDPSPSSRRRSWTPKRVKGAASLLQL
LSIPRIRWSSSNEDDDKIELTRAEVESLRSEIADADERESQLKARLENIDEVLRYARLSG
YLHIRSRWTQLPGEPPIIDDADVDDWLPRFVVLQGQCIYYYLKSTDLSPQESTLLCDIVE
VGRLPNFVPEDGKTRHAFYMLTRQGLRFECSSNCEIQVDSWARAVGSDCRLEGGEVKTGG
SW
Download sequence
Identical sequences I1HFQ0
EG:BRADI2G14200.1 15368.BRADI2G14200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]