SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G15750.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G15750.1
Domain Number 1 Region: 123-327
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.08e-31
Family Fungal lipases 0.0039
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G15750.1
Domain Number - Region: 322-383
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 0.0565
Family Molybdenum cofactor-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G15750.1   Gene: BRADI2G15750   Transcript: BRADI2G15750.1
Sequence length 425
Comment pep:novel chromosome:Brachy1.0:2:13939714:13941706:1 gene:BRADI2G15750 transcript:BRADI2G15750.1
Sequence
MAPKLGSISNRWRELHGASSWAGLLDPLDADLRASVIAYGELAEATYDGFNTERRSPHAG
ACVYGHADLLAGADVSSPGNYAVTKFLYATCGITQLASTSTTRESTSASRLAKAFLVLPV
PELKEEPWCRESNWMGYVAVATDDGVAALGRRDIVVAWRGTLESLEWVNDLDFLPASAAP
VLGPAAEEHGNAVVHHGFLTVYTASDEDSKYNKTSARDQVLEEVKRLMELHKGEVTSITL
TGHSLGASLAILNAVDIVSNGLNTPSTSSSSSSQLPPCPVTAIVFACPHVGNDDFKSAFA
SFSDLRALHVINARDIVPLYPPIGYVDVATAALRIDTSRSPYLRSPGTPQTWHNLECYLH
GVAGEQGGQGRGFRLEVDRDVALVNKGSDALKDEYPVPANWWVVSNKGMVRGAGGHWKLK
DFEEI
Download sequence
Identical sequences I1HG65
EG:BRADI2G15750.1 XP_003567848.1.954 15368.BRADI2G15750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]