SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G15900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G15900.1
Domain Number 1 Region: 873-1182
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.23e-49
Family WD40-repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 582-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000505
Family Protein kinases, catalytic subunit 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G15900.1   Gene: BRADI2G15900   Transcript: BRADI2G15900.1
Sequence length 1186
Comment pep:novel chromosome:Brachy1.0:2:14059875:14066798:1 gene:BRADI2G15900 transcript:BRADI2G15900.1
Sequence
MEGTTAAVVGGDGAAGDAQIKGGKENGQQALQLQRPLQPSGGSEALEMPPTPLPIARDLD
WSEHFSFFNSAGGFTDGARGLASTGLSNSVSRPDSVTQCCLEGTDERVEELTVGNCISSD
AQPHASAGGSSSGGERPAVVRGLWGNFTRMAWRSSDVASRENLAAGRGDIANLRTGDVAS
RETLAVNLGNNMISQNNLRTGNVASRENLAANLANSIIAQNNLRTADMVSRENLAANLGN
SMISQSIDASGKEMPFSRGDNANSEFNMSFGNQQQPIPSSRLNQTEQRFERENGLKVSSF
SNRIIDQMRNKTATPSSGVQGFPFKTASKGKGVTYQSAREEIQAQANVRPRVPMDRISKI
PSSTHNSMARLDGAFFNGGGNASESQNEGTSLRELIRPTGQVTSKFEKMQLFKQILDHVD
KSHARGLTLQHVRPSYFIVSPPNQVKYTGSYATQDLSAPAKPDIATDDMFNRKRRFDQKN
AHQEFNGNGNPNSILKYQKVGDQGSVAVRRPTHTFRTDHRGGNQSEDVDPGASGQGNSSC
TVRGRFNFGEPYYGNGNNASYAQRLSNYGNQESVLDLRLLEDSWYRSPEELSQLKGTFPS
NIYSLGVILFELFCCCETWELHCAAMSDLRHRILPPNFLSESPREAGFCLWLLHPDPRSR
PKARDILGCDLINEGRDLSLLDNKVPAAVNEEDTESGLLLNFLSQLKEEKEMQASKLSAD
LAGLQTDIAEVERRHSLRNGFSLEDMGVLASSNDLPGTSSDALRGGSLSGLLPPICRSSI
YEQRVMRNLEQLENAYYSMRSTIDTSETNVIKRSDNDALRVRDNFYQLHGDTDAMNEQTD
RLGCFFDGLCKYARHSRFEVRGILKNADILNSPNVICSLSFDRDEEYFAAAGVSKKIKIF
EFDALLNDRVDIHYPLIEMPSKSKLSCVCWNSYIKNYLASTDYDGTVQLWDASTGQGFTQ
FTEHRKRAWSVSFSEVDPTKLASGSDDCCVKVWSINQKNCVDTIRNVANVCCVQFSPYSS
RMLAFGSADYKTYCYDLRHTRIPWCTISGHGKAVSYVRFLDPETLISASTDNTLKIWDLN
RTNSSGLSSSACSLTLSGHTNEKNFVGLSVHDGYITCGSENNEVYSYYKTFPMPITSHKF
GSIDPITGQETNDDNQQFVSSVCWRGRSNMVVAANSSGSIKVLELV
Download sequence
Identical sequences I1HG80
XP_010231002.1.954 EG:BRADI2G15900.1 15368.BRADI2G15900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]