SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G16170.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G16170.1
Domain Number 1 Region: 194-414
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.95e-61
Family BC ATP-binding domain-like 0.000000485
Further Details:      
 
Domain Number 2 Region: 420-517
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.76e-30
Family BC C-terminal domain-like 0.00017
Further Details:      
 
Domain Number 3 Region: 90-193
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.63e-26
Family BC N-terminal domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G16170.1   Gene: BRADI2G16170   Transcript: BRADI2G16170.1
Sequence length 525
Comment pep:novel chromosome:Brachy1.0:2:14235327:14239984:1 gene:BRADI2G16170 transcript:BRADI2G16170.1
Sequence
MDFAAYSIRGPLKLAVGHDPYALSNNHLCCGWRPPASCAVSRVSSSNIPSNVVRHVVRDS
PHLIALNSERLRSSLKASVLDGSIVAEDKITVLVIGGGGREHALCYALNRLPSCVSVLCA
PGNVGIAQSGDATCVSDLDISSSDAVISFCHKRAVGMVVVGPDAPLVACLANDLVKAGIP
TFGPSSETAALEGSKDFMKKLCDKYNIPTAKYRTFMDPVEAKQYVKDQGAPIVIKADGLA
AGKGVVVAMSLDEAFEAIDCMLVEGSFGSAGSQVIIEEYLEGEEASFFALVDGENALPLE
SAQDHKRVGDGDVGPNTGGMGADSPAPIVTEELKRMVMESIIIPTVKGMAAEGRRFVGVL
YAGLMIEKKSGLPKLIEYNVRFGDPECQVLMMRLESYLAQVLLSACKGELGKVSITWSPE
IAMVVVMASEGYPGSYKKGTVIKNMDNAEQVSPAVKIFHAGTALDGDGNLVAVGGRVLGV
TAKSKDIEEARARAYDAADAIDWPEGFFRRDIGWRALKHEQMANC
Download sequence
Identical sequences I1HGA9
XP_003567871.1.954 15368.BRADI2G16170.1 EG:BRADI2G16170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]