SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G17847.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G17847.1
Domain Number 1 Region: 213-599
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.5e-96
Family Regulator of chromosome condensation RCC1 0.00088
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-24
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 598-666
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.15e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G17847.1
Domain Number - Region: 818-892
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G17847.1   Gene: BRADI2G17847   Transcript: BRADI2G17847.1
Sequence length 1048
Comment pep:novel chromosome:Brachy1.0:2:15882966:15888615:1 gene:BRADI2G17847 transcript:BRADI2G17847.1
Sequence
MTPDDNSIITLKKGSKLIKYSRKGKPKIREFRLSSDETILVWYSKHKEKCLKLSAVSKII
PGQRTAVFRRFLRPEKDYLSFSLIYKNGQRSLDLVCKDQAEVEVWFSTLETLITSCRVTD
CQSDRVSFSDEVTQYQDSNLYGTTVDIASSITRTFNSAGYSTANSLNSSRADVGSDRANM
LRVSTGDSSRISISSSIPSSSSQGSGPDDIESLGDVYVWGEVWTDVIPSEGSSNLVCSKT
DVLIPKPLESDVVLDVQQISCGSRHIALTTRQGEVFTWGEELGGRLGHGTDEDISRPKLV
ESLAVSNVEYIACGEFHTCAVTASGDLYNWGDGSYNAGLLGHGIGASHWLPKRVSGPLEG
LQVLSVACGSWHSALAMSSGKVFTFGDGTFGALGHGNRENVAYPKEVESLSGFRTMKVAC
GVWHSAAIVETTSQTGVNMVSRKLFTWGDGDKNRLGHGDKEARLVPTVVQALVDNNFHQV
ACGYSMTIALATSGHVFTMGSSNYGQLGNPKADGKQPCQVQDKLSSELVEEISCGSYHVA
VLTSRSEVYTWGMGANGRLGHGGIEDKKKPTIVDALKDRHVKSIACGSNFTTCICIHKWV
SGADQSVCSGCRQPFGFTRKRHNCYNCGLVHCHACSSRKVLKAALAPTPGKPHRVCDSCF
MKLKAADSGSNSPYNKKSVITRRSVDIKEKSERPDIRPSRLATAAPAEPMKHADTKSVRN
DVKPDPTTMARAPQALSVPTTVTKPMGMGMGMGMGMGMGMGMGGMGGMGGMGMGMGGAMP
MGMGQMGMGMPMVSPAQPKKSNPSPATVSPLAIKSDTKSDTDGMKKTIETLNQELSKLQT
QVTKLKQKCEVQDEQLQKSEKRAKSAASLASEESARRNAVLDFVRFLDSELKGVADQVPT
EFTDSIKTLQSHSEKFLTGQCSHPPEGIPGHDQPRLSSGGLHEIAHHRSASMGNLVLSQD
GSSAAGISMTSESPCHRLMESNGRAPGDFAPKYGTHGEVQLIEQFEPGVYVTLIQMRDGT
KVFKRVRFRYSILTPVTTSCIHLNSINP
Download sequence
Identical sequences I1HGW8
EG:BRADI2G17847.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]