SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G18970.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G18970.1
Domain Number 1 Region: 11-282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-98
Family Protein kinases, catalytic subunit 0.00000479
Further Details:      
 
Domain Number 2 Region: 323-396
Classification Level Classification E-value
Superfamily KA1-like 0.000000105
Family Ssp2 C-terminal domain-like 0.032
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G18970.1
Domain Number - Region: 276-325
Classification Level Classification E-value
Superfamily UBA-like 0.0646
Family UBA domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G18970.1   Gene: BRADI2G18970   Transcript: BRADI2G18970.1
Sequence length 396
Comment pep:novel chromosome:Brachy1.0:2:16730349:16735043:1 gene:BRADI2G18970 transcript:BRADI2G18970.1
Sequence
MDAAGRDANPLKGYRIGKTLGIGSFGKVKIAEHIITGHKVAIKILNRRKIKSMEMEEKVK
REIKILRLFMHPHIIRLYEVIDTPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQ
IISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNVMRDGHFLKTSCGSPNYAAP
EVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPLAR
DLIPRMLVVDPMKRITIREIREHSWFKARLPRYLAVPPPDTAQQIKKLDDETLNDVIKMG
FDKIQLTESLQKRLQNEATVAYYLLLDNKLRTTSGYLGAEYQESMDSSFSQISPETPNSA
SEARQFGSPAFGLRQHFAAERKWALGLQSRAHPREI
Download sequence
Identical sequences I1HHA5
15368.BRADI2G18970.1 EG:BRADI2G18970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]