SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G20687.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G20687.1
Domain Number 1 Region: 521-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-82
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 65-170,202-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.16e-21
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G20687.1   Gene: BRADI2G20687   Transcript: BRADI2G20687.1
Sequence length 862
Comment pep:novel chromosome:Brachy1.0:2:18172471:18179213:-1 gene:BRADI2G20687 transcript:BRADI2G20687.1
Sequence
MASRSPRISFLLLPQLLSLLLLPWASHARDAISPGQPLRGNETLVSAGGGSFALGFFTPP
GSNNTYLGVWYARVSVRTVVWVANRAAPIRGPLDHNARAALSVSADCTLAVSDSNSTIVW
SAPPAAGLGLGRDCTARIQDDGNLVVVAAAAADGGEGERVSWQGFDHPTDTLLPGMRVGV
DFESGTNMTLTAWASPSDPSPGPVVAVMDVSGDPEVFIWNGDEKVWRSGPWDGVQFTGVP
DTATYSGFTFRFVNSDREVTYSFHLAPGATIVSRLALNSTGLLQRWTWVESANKWNMYWY
APKDQCDAVSPCGANGVCDTNALPVCACLRGFSPRQPDAWAMRENRAGCARATPLDCARA
GNGNGTSDGFTVVPHAKVPDTTNATVDFGASLDQCRRLCLANCSCAAYASANLSRAQGQR
GCVMWYGGLEDLRVYPNFGQDLYVRLAAADLDSISKSKKKVQVITAVTVSIGTLAVILAL
IGFFFWRRKRTKSRLPGPNKWSGISHSRGLQSEGTSHGDDLELPIFDLETIAAATDSFST
DNKLGEGGYGPVYKGKLEDGEEIAVKTLSKASTQGLDEFKNEVMLIAKLQHRNLVRLLGC
CICGEEKILIYEYMANKSLDFFLFDKSRSMLLNWQTRYRIIEGIARGLLYLHQDSRYRIV
HRDLKTSNILLDEDMIPKISDFGMARIFGGNDSEINTLRVVGTYGYMAPEYAMDGVFSVK
SDVFSFGVIVLEIITGTRNRGVYSYSNHLNLLAHAWSLLNEGNSLDLVDGTLKGSFDTDE
VLKCLKAGLLCVQENPEDRPLMSQVLMMLAATDAASLPTPKQPGFAARRAAAATATATED
TSSSRPDCSFVDSMTITMVEGR
Download sequence
Identical sequences I1HHX6
XP_003566068.1.954 EG:BRADI2G20687.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]