SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G24280.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G24280.1
Domain Number - Region: 70-131
Classification Level Classification E-value
Superfamily Chalcone isomerase 0.0301
Family Chalcone isomerase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G24280.1   Gene: BRADI2G24280   Transcript: BRADI2G24280.1
Sequence length 163
Comment pep:novel chromosome:Brachy1.0:2:22114529:22116204:-1 gene:BRADI2G24280 transcript:BRADI2G24280.1
Sequence
MEEVQAAVTAHLDQVSGLVQALSYELRRGIGPAADSLLAFVHAVDWTEPWLMCLMAFHAS
LLLAVVRLRRNANLQFFLLFLAYSGVYLAEKINIYLAEHWKSFASRNYFDRSGVFISIVW
SAPLIFISIVTVVSSLITLCQLMVKWKRAELRHRVRLARDKQE
Download sequence
Identical sequences I1HJ34
15368.BRADI2G24280.1 XP_003568384.1.954 EG:BRADI2G24280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]