SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G24967.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G24967.1
Domain Number 1 Region: 526-818
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.65e-42
Family WD40-repeat 0.00076
Further Details:      
 
Domain Number 2 Region: 14-72
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000024
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 223-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000497
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G24967.1   Gene: BRADI2G24967   Transcript: BRADI2G24967.1
Sequence length 821
Comment pep:novel chromosome:Brachy1.0:2:22766892:22771359:1 gene:BRADI2G24967 transcript:BRADI2G24967.1
Sequence
MASAALPRPDTEPPECPVCLSPFDAASVVPRVLPCGHSLCGSCISSLPPASASAGASSLR
CPLCSQCVPFSRALGPSSLPKNLALLSFLPSLPNASPASTAAAAHPRPLPLHAAHSGLLA
RFRHAILPESASPLSSAPPGPAPTGLAVGSIAFDLGAPWFCLRGEPVSLLPVEAPAGGPP
AQEAAFYRPSHASRVVAVIDALSGGAKEEVINLVAASARLARRVCRVFGVWMGPEVATLW
LVSERHTRRVPRLLDETTNGLDMVARIRAFGMEVCEALMELQGEGLVLGCLRLDCFCLDR
FGRCLLNLNEVLVLCRGVRAGLCLTKGGALVAPEMAAVLSDATRMRSRDFDGLVGHNSDV
WLLGCILVAFVTGDEQLAARWDTYGSHDDWQKEVLTRLGAVLIGTQLEPLVAITASCLSY
DPEERPEISDVWKCIRGSWMKPASDALAAMDGLAAQKGLRCLLLGELSSMYSGPGAIESD
DKMQSSRGSDDEILTPDDERNHGCMNNETVCAAEINEPQRDGVFKSLTLLAHRDCVTGLA
IGGGFLFSSSYDKTINVWSLQDFSHVQTLKGHEHKITTIIAVDNDNQSLCISGDSGSGIF
VWHVDTSLKQEPLHNWHEHNDWIYRGVHCLAVSGTGYLYTGSRDKSIKAWSLEDYSLCCT
MTGHKSTVSCLAVASGILYSGSWDGTIRSWWLTDHSPLSVLEDNTPGSTAPVLSISTEVN
FVVSSHENGCLKIWKDDVLVKSEKIQNASIYAVKLNGKWLYTGGLGKVINIQELLEEESE
VEIRDVASIACDSVVTSILYWDERLIVGFSNREIKVYDKGS
Download sequence
Identical sequences I1HJA1
XP_003568424.1.954 EG:BRADI2G24967.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]