SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G25280.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G25280.1
Domain Number 1 Region: 500-732,761-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-72
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 69-173,205-235
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-27
Family alpha-D-mannose-specific plant lectins 0.0022
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G25280.1
Domain Number - Region: 390-433
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000883
Family Pan module (APPLE domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G25280.1   Gene: BRADI2G25280   Transcript: BRADI2G25280.1
Sequence length 849
Comment pep:novel chromosome:Brachy1.0:2:23221492:23224240:1 gene:BRADI2G25280 transcript:BRADI2G25280.1
Sequence
MAGAIPAGCSTLLMLLGLLLLICTGGLPLVRGADTVSAGRPLSGNQKLVSAGGKFALGFF
QPNGGAAGRWYIGIWYHNISMQTPVWVANRDSPVRDPATSRLAMAPDGNLALFDGNSSSL
SPVWSTNANASSIAGATGVIAVLLDTGNLVLAPASSNASSAVPLWQSFNHVGDTWLPGGK
LRRDKRTGEIQGMVSWRARGDPGTGSYALQLDPSGTPQYVLLWNGTREYWATGNWTGRSF
TGAPEVAASSGGSGYSFEFVDNEVESYFTYNFAVNSTVYRFVMDVSGQVKGWFWVEATQG
WNLVYAEPKDPCVVPRGCGAFGVCSESASAACDCARGFRPLSPASWALGDFTAGCVRGSQ
LQCAKNSSGGLNKVEQDKFLRMDVVRLPDDGRVLTGAASSGGDCQRACLGDCTCSAYAYN
GSCFLWHDDLFNLQGGVGEGSRLYLRLAASELPGARSHKWRNIKIVLGALGVFCFVIAAS
ILLVRVTRKRRAKRVNGLTIGDGSVTSFKYKDLQFLTKNFSDKIGGGAFGSVFKGQFSDN
TVVAVKKLEGLRQGEKQFRAEVSTLGTVQHVNLIRMLGFCSEGGDRKLLVYEYMPNGSLD
RHLFRKTFYVLSWKARYQVALGVAKGLSYLHDKCRDCIIHCDVKPENILLDGSFAPKVAD
FGLAKLVGRDFSRVITTMRGTIGYLAPEWISGEAITAKADVFSYGMMLFEIVSGRRNIEE
GQRRFEIEMSSSTAATADAGGEQATATATSFFPLVVARRLMEEGDVKPLLDPELEGDANA
EELRRVCKVACWCIQHSVDARPTMAVVVQALEGLTNVEMPPVPVYLEVLAGRPAHETADH
SLYYTPDAV
Download sequence
Identical sequences I1HJD9
15368.BRADI2G25280.1 EG:BRADI2G25280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]