SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G25745.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G25745.1
Domain Number 1 Region: 95-463
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-138
Family Pyruvate phosphate dikinase, N-terminal domain 0.00000000000973
Further Details:      
 
Domain Number 2 Region: 605-957
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 6e-127
Family Pyruvate phosphate dikinase, C-terminal domain 0.0000000000103
Further Details:      
 
Domain Number 3 Region: 473-597
Classification Level Classification E-value
Superfamily Phosphohistidine domain 7.98e-38
Family Pyruvate phosphate dikinase, central domain 0.00000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G25745.1   Gene: BRADI2G25745   Transcript: BRADI2G25745.1
Sequence length 959
Comment pep:novel chromosome:Brachy1.0:2:23906158:23921663:1 gene:BRADI2G25745 transcript:BRADI2G25745.1
Sequence
MPSVSKAVCLQQRPSTGGGRRAREAGRRSVAAPRARHSKPKAVHSGGSESGRGQHCSPPK
AVAAPTIPATEKFILMAPAQCARVQRVFHFGKGKSDGNKAMKDLLGGKGANLAEMASIGL
SVPPGFTVSTEACEQYQAAGRALPPGLWEETLEGLRWVEEYMGARLGDPKRPLLLSVRSG
AAVSMPGMMDTVLNLGLNDDVAAGLAAKSGERFAYDSYRRFLDMFGNVVMDIPHALFEEK
LEAMKATKGVHNDTDLTASDLRELVSQYKNVYVEAKGEQFPSDPKKQLQLAVLAVFDSWD
SPRANKYRSINQITGLRGTAVNVQCMVFGNMGNTSGTGVLFTRNPSTGEKKLYGEFLVNA
QGEDVVAGIRTPEDLDAMKNQMPEAYVELVENCKILESHYKDMMDIEFTVQENRLWMLQC
RAGKRTGKGAVKIAVDMVNEALVDCSTAIKMVEPGHLDQLLHPQFANPGAASYKGKVITT
GLPASPGAAVGQIVFTAEDAEEWHAQGKSAILVRTETSPEDVGGMHAAAGILTARGGMTS
HAAVVARGWGKCCVSGCSSIRVNDIEKVVTIEGKVLQEGDWISLNGSTGEVILGKQPLSP
PALSGDLETFMAWVDEVRQLKVMANADTPEDALTARKNGAEGIGLCRTEHMFFASDERIK
AVRQMIMAPNIQLRQKALDCLLPYQRSDFEGIFRAMDGLPVTIRLLDPPLHEFLPEGHVE
DIVRELCSETGAAEDDVLARMEKLSEVNPMLGFRGCRLGISYPELTEMQARAIFEAAIAM
TNQGIQVFPEIMVPLVGTPQELGHQVTLIRQIANRVFTDMGKAIDYKVGTMIEIPRAALV
ADEIAEQAEFFSFGTNDLTQMTFGYSRDDVGKFLPIYLAQGILQHDPFEVLDQRGVGELV
KIATERGRKARPNLKVGICGEHGGEPSSVAFFAKAGLDYVSCSPFRVPIARLAAAQVLV
Download sequence
Identical sequences I1HJJ6
EG:BRADI2G25745.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]