SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G26650.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G26650.1
Domain Number 1 Region: 352-537
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.53e-35
Family G proteins 0.007
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G26650.1
Domain Number - Region: 88-162
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 0.000115
Family Thiamin phosphate synthase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G26650.1   Gene: BRADI2G26650   Transcript: BRADI2G26650.1
Sequence length 915
Comment pep:novel chromosome:Brachy1.0:2:25386862:25394874:-1 gene:BRADI2G26650 transcript:BRADI2G26650.1
Sequence
MFAASTATTRLLLPRPAGPCRGLPFHPLLLPRHRSRRAVDARSAASGGSGAAKQPPRTLF
PGGFKRPEIQVPALVLRVGVDEALGSGDTVASAVARGVGIVVLEAGEEGGGRAYEAARAL
KAAVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSESIYLPLVARTV
QSSDSARSASSSEGADFLIVNTRTDDFSSAISGVGAQNVKIPIFFTLNDSQSEGSYSDTS
SKLLQSGASGIVLSLAGIHHLTDNIIERDFSRVDTTDGVPQATYLSASTSEETNNVMVLS
REKTKVAGFTKLDEKVMELIAMEKPILNEAVAVIRKAAPMMEEVELLVDAASRLSEPFLL
VIVGEFNSGKSTFINALLGRQYLQEGVVPTTNEITLLSYSEVDSESMERCERHPDGQFTC
YLSAPILKEMNLVDTPGTNVILQRQQRLTEEYVPRADLILFVLSSDRPLTESEVGFLQYV
QQWKKKVVFVLNKLDLYRNSDELEEATAFIKENARKLLNTEHVTLFPVSSRSALEVKLSY
SKNNDREHYGKVLLNDPRWRSSKFYDLEHYLLSFLDGSTDNGKERVRLKLETPIGIADRL
LTSCQRLVKLEYEKSIDDLTAIKDLVSGANSYAVKIEADSNSWQKQISSLIERAKSRAIT
LMESTLQLSNIDLISTYMLAGEKGTSAKATSFVQNDILSPALDDAVNLMGEYSTWLSSSN
IREANLYLECFHERWSSLLTQEERLPSDPNELVNEGEKLSIKALNGFSAYAAAKVFEAEI
REVATGTFGGLGVAGLSASLLTSVLTTTLEDLLALALCSAGGFFAISNFPGRRKLALEKV
SKAADDLSRKVDEAIQEDISQSASKLVQFVDVLSKPYQDACQRKIDWLQGVQGEMSAVER
KLQTFKVDIQNLHGP
Download sequence
Identical sequences I1HJV5
XP_014754906.1.954 EG:BRADI2G26650.1 15368.BRADI2G26650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]