SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G26807.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G26807.1
Domain Number 1 Region: 268-658
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-98
Family Regulator of chromosome condensation RCC1 0.00067
Further Details:      
 
Domain Number 2 Region: 20-128
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-26
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 657-725
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G26807.1   Gene: BRADI2G26807   Transcript: BRADI2G26807.1
Sequence length 1090
Comment pep:novel chromosome:Brachy1.0:2:25538171:25545914:-1 gene:BRADI2G26807 transcript:BRADI2G26807.1
Sequence
MMSDASSDLGGGRAGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWF
SGKEEKQLRLNHVSRIIPGQRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVW
FAGLKTLISRSHQRKWRTESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGAENY
RLRSPYGSPPKVGLEKAFSDIVSYTAPPRPFFPSDSNVGSVHSVSSGHSDNTNGHSRGLP
MDNFRVSLSSAVSSSSHGSGHDDGDALGDVFMWGEGTGEGILGGGNSRFGNSSGAKMDCL
LPKPLEFAGRLDVQNISCGGRHATLVTKQGEVYSWGEESGGRLGHGVDCDVPQPKLVEAL
AHMNIELVACGEYHTCAVTLSGDLYTWGNGTFNFGLLGHGNEVSHWMPKRLNGPLEGIHV
SSISCGPWHTAVVTSAGQLFTFGDGSFGVLGHGDRQSLSVPREVESLKGLRTVRAACGVW
HTAAVVEVMVGNSSTSNCSSGKIFTWGDGDKGRLGHGDKDTRLVPTCVASLVEPNFCQVA
CGHCFTVALTTSGHVYTMGSSVYGQLGNPQADGMVPARVEGKLHKNFVEEISCGAYHVAV
LTSRTEVYTWGKGANGRLGHGDTDDRNSPTLVEALKDKQVRSVVCGINFTAAICIHKWVS
GVDQSMCSGCRLPFNLRRKRHNCYNCALVFCHSCSSKKSLKASLAPNPNKPYRVCDNCYC
KLNKGPETDRYSSAKRGAVLQGFNDPINEELETRSNVQLSRLSSMESFKNMDSRYSKKNK
KFEFNSSRVSPIPNGSSHWSGLNISKSFGSSKKFFSASVPGSRIVSRATSPVSRRSSPPR
STTPTPTLGGLTSPRVVVDGAKPMKDGLNQEVINLRSQVENLTRKSHLLEVELERTTKQL
KEAISIAGEETAKCKAAKEVIKSLTAQLKCMAEKLPEGAVAVPVKHNRLPPLSGIPLPSD
ISMAYENLGSPRSSGEPYSNGSNGSIVSNGPSSVRNKTHLEVGKNGTRQPDSDSKLESEW
VEQDEPGVYITLTALPGGARDLKRVRFSRKRFSETQAEQWWQENRARVYELYNVRVVDKS
VASIDSDVPH
Download sequence
Identical sequences I1HJX4
EG:BRADI2G26807.1 XP_003568548.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]