SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G27230.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G27230.1
Domain Number 1 Region: 505-542
Classification Level Classification E-value
Superfamily WW domain 0.0000000000136
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G27230.1   Gene: BRADI2G27230   Transcript: BRADI2G27230.1
Sequence length 1622
Comment pep:novel chromosome:Brachy1.0:2:26029287:26037785:-1 gene:BRADI2G27230 transcript:BRADI2G27230.1
Sequence
MMRGKSARRDTSVVVVVLETSEVYIVVSLLAAGDTQVISVDPTTGALCYQGKQGEDLFDS
EAAALNYITNGSRFLSKSTTYAKAVLGYAVFGSCALLLVATQLSATVSGLPGGGCIYTVV
ESQWIKIQLQNPQAQGNGEIKNIREFSDLDIDGKYYFCETRDITRPFPSRMTLQEPDEEF
VWNGWLSKPFKDIGLPLHCVILLQGFAECRNFGGTGQQAGLVALIARRSRLHPGTRYLAR
GLNACSGTGNEVECEQLVWAPQKNGQTIPFSSYIWRRGTIPIWWGAEIKNAVSVEAEIYV
ADDPYNGTLQYYQRLGRRYGNKSSQVDAARQKKPGMVPIVCVNLLRYGEGKPETVLVEHF
KESLKYLKSTGKLGNTWIQLINYDWHATVKLKGQQQTVEGLWRHLKAPTMAIGFSEGNYY
SVKEQLKDCRGPIISNGDGGFCMESIQNGVIRFNCADSLDRTNAASYFGALQVFVEQCSR
LSISLDVDAMFGLSASRYSEYNGRNARSLPPGWEERFDSVTGKSFYIDHNTRTTSWEHPC
QEAPQKPWKRFDMTFEQFKSSTMLNPVNHLAEIFLLAGDIHATLYTGSKAMHSEILNIFK
EETGKFGKFSAAQNVKITLQRRFHNYMNDSSRQKQFEMFLGLRLYKHLPSIPIFPLKVLS
RPSGCMLKPVPSITPMADGGNSLLSFKRKDLIWVCQHGADYVELFIYLGEPCQVCQLLLT
VSHGVEDSSYPASVDVRVGSSIDALKLVVEGACIPQCSNGTNLLFPLTGRIDPEDLAVTG
KSARPDVQESTYLPLLYDFEELEGELNFLNRVVALSFHPSALARTAITLGEIEVLGVSLP
WVDMLTNSKRVTETLELLHEKSYSIPRDPGLKDVAHFSSSEYGVHGNERTYTQSSPSVQT
AGSGNFVDFLTGDIGMSNQSKMTGNTSYGNEEQTNFFDEEFDINPFATASEEPVAIVNKQ
VEDCGHTKFYLEFFESLSGNKKGKSLNFEQMMKLEIKRFYLDLSAAERDRALLSIGVIPA
TVDPNRSVDYSYLLKLSNLADKLALLGHAVFEDRANASIGLEKVNNHAIDFWNISENGEL
CSGGACEVRYLSSLQASATSENVSLFVECSQCERTACKSCCAGKGAFLLLGNTYRDLKIY
GGSQGGGYSALADSSVCKSCCSEVIKHALYVDYVRVLHSLRRKGRAEKAALKAVNQVCRL
EPSKISDSVHSVQSGQRQLKQLLDGEESLAEFPYAGFLHTVETADDSEPLLSLLAPLGSG
VYKSYWKAPLENTSLEFPIVLGGLSDVSGVAIIVSSCGYSRSDCPIVEIWSSNKIQREDR
TFIGKWDVQDIIVSSPELCGPEKSSSLNEAPRHIKLHFPNPFRCRIISIKMTLPCIGSRS
TKFNDEFDLLSLDESSFPDSKPSNPHSSFIHAKRIVVFGSSLRKEMDPDASAGIMRTKSY
LDGSPPLGRFRIPVEAERLTDNDLVLEQYLLPNSPGIAGFRLDSFSVIRPRVTHSPLSSE
LDMSEFSLTRMEDRHVNPAVLHIQVTIVKESGKLVVEEYRLPEVKANTQLYFDFLDLQQD
ARCVIFRLLGDVTSFVDDIAEIDGLNLRNLPLASGLSLSNKIKLYYYADTYEMGKIGSLA
AV
Download sequence
Identical sequences I1HK22
XP_003566312.1.954 XP_010231474.1.954 EG:BRADI2G27230.1 15368.BRADI2G27230.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]