SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G27947.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G27947.1
Domain Number 1 Region: 326-505,548-594
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.65e-40
Family Phospholipase D 0.055
Further Details:      
 
Domain Number 2 Region: 727-981
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.61e-29
Family Polyphosphate kinase C-terminal domain 0.075
Further Details:      
 
Domain Number 3 Region: 247-346
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000192
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G27947.1
Domain Number - Region: 58-99,170-204
Classification Level Classification E-value
Superfamily PX domain 0.0543
Family PX domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G27947.1   Gene: BRADI2G27947   Transcript: BRADI2G27947.1
Sequence length 1111
Comment pep:novel chromosome:Brachy1.0:2:27073464:27087105:1 gene:BRADI2G27947 transcript:BRADI2G27947.1
Sequence
MPPEHESEGDASSSSVPGPAPRPEVLAASASFRLSEATRVFEELPRATIFSVSRPEAGDI
TPMLLSYTIEINYKQFRWRLFKKASQVLYLHFALKRREFLEEFHEKQEQVKEWLQNLGIG
DNMPVVHDEDEVDDVNVPSQPDESSIRNRNVPSIAVLPVIRPALGRQHSISDRAKVAMQE
YLNHFFGNLDIVNSREVCKFLEVSCLSFLPEYGPKLKEDYVSIGHLPKIQKGRKEKCCSC
GLFNCCKSNWQKVWVVLKPGFLALLKDPFDPKLLDVIIFDALPHMDINGEGQISLAKEIK
ERNPLHFGFQVSSGGRTIKLRTRSSGKVKDWVTAINAARQPPEGWCYPHRFGSFAPPRGL
LEDGSMAQWFIDGQAAFEAIASSIEHAKSEIFITGWWLCPELYLRRPFEHHGSSRLDALL
EARAKQGVQVYILMYKEVALALKINSLYSKQRLLNIHENVKVLRYPDHFSSGVYLWSHHE
KIVIVDNQVCYIGGLDLCFGRYDSPEHKVMDVPPVIWPGKDYYNPRESEPNSWEDTAKDE
LDRTKYPRMPWHDVQCALYGPPCRDVARHFVQRWNYAKRNKAPNEQAIPLLMPHHHMVIP
HYKGRGKETNGEAKGKQNHVENVDVKRTASLASCASCQDVPLLLPQELEPQALPDGDLAV
TGLDINQADNPNKTGFKQPLLNRKAKIDASRQDLPMRGFVDNLSSIESAPIRRFDSLKEE
RHHMDTEWWEMQERGDQLASVLDIGQVGLRATCCCQIIRSVGQWSAGTTQIEGSIHNAYF
SLIEKAEHFVYIENQFFISGLSGDDTIKNRVLEALYRRILRAEREKKRFKAIIVIPLLPG
FQGGIDDGGAASVRAIMHWQYRTICRGPNSILQNLYDVIGPKAHDYISFHGLRAHGRLSD
GGPLVTSQIYVHSKLMIIDDRIALIGSANINDRSLLGSRDSEIAVVIEDKEVVNSKMDGR
HWEAGKFSHSLRLSLWAEHLGLHRGEVSHIMDPMDDSTFKNIWMATAKTNTMIYQDVFSC
VPNDLIHSRTQFRQSIAHWREKIGHTTIDLGVAQEKLETYQDGDLKSTDPMDRLQLVRGH
LVSFPLDFMCQEDLRPYFSESEYYTSPQVFH
Download sequence
Identical sequences I1HK84
EG:BRADI2G27947.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]