SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G28007.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G28007.1
Domain Number 1 Region: 413-802,847-1148,1197-1427
Classification Level Classification E-value
Superfamily ARM repeat 1.68e-114
Family PBS lyase HEAT-like repeat 0.078
Further Details:      
 
Domain Number 2 Region: 1991-2154,2189-2329
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.73e-97
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0037
Further Details:      
 
Domain Number 3 Region: 1914-2007
Classification Level Classification E-value
Superfamily FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) 7.19e-40
Family FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) 0.0000111
Further Details:      
 
Domain Number 4 Region: 59-523
Classification Level Classification E-value
Superfamily ARM repeat 1.01e-33
Family Armadillo repeat 0.025
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G28007.1
Domain Number - Region: 1438-1508,1590-1632
Classification Level Classification E-value
Superfamily TPR-like 0.000778
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G28007.1   Gene: BRADI2G28007   Transcript: BRADI2G28007.1
Sequence length 2466
Comment pep:novel chromosome:Brachy1.0:2:27176229:27207460:-1 gene:BRADI2G28007 transcript:BRADI2G28007.1
Sequence
MKPSPHFPEIGKKSKDLVAKDHSFNIGAYISSGADAISAALRKHVEEEARDLSGETFLRF
MDQLYEQIYILLQSNDVSENLLALRAIDALIDMPFGEGASKVSKFASFLRNVFEVKRDPE
ILVPASTVLGHLAKAGGAMTAEEVERQIKTALGWLGGDRVEYRRFAAVLILKEMAENAST
LFNVHVTEFVDAIWVALRDPKQAVRERAVEALRACLHVIEKRETRWRVQWYYRMCEAAQV
GLGKNASVHSIHGSLLAVGELLRNTGEFMMSRYREVADIVLTYLKHRDQLVRRSITSLLP
RIAHFLRDRFVTNYLKICMDHILFVLRTPDERASGFVALGEMAGALGAELVPSLPLISPH
LHDAIAPRRGRPSLEAITCVGSFAKAMGLAMEPHIRGGLLDAMFSAGLSEKLVDALESIS
TSIPSLLPTIQERLLDCISQALPKSSTRPGATVNRTTRSSSLQQFVDSNGPVHVQLALRT
LATFNFKGHELLEFARDSVTLYLEDEDSSTRKAAAICCCRLVAHSFSASSTSQFSSNRSN
RIGGAKRRRLVEEIVEKLLIAAVADADVGVRSSVFKALYRNPTFDDFLAQADILTSIFVA
LNDEEYGVRELAISVAGRLSEKNPAYVLPALRRYLIQLLTYLDQSMDSKCREESARLLGC
LIRSCARLILPYIAPIHKALVARLCEGAGPMANNVLAAGVLATVGELAKVGGFSMRQYLP
ELMPLVVDALLDGGAVSKREVAVATLGQVIQSTGYVIAPYNEYPQLLGLLLKLLNGELEW
STRLEVLKVLGIMGALDPHAHKRNQHNLPGQHREVLRPTIETAQHIVSMEETPTDFWPSF
SASEDYYSTVAINSLMRILRDPSLSSYHQMVVGSLIFVFKSMGLGCVPYLPKVLPELFRA
VRMCEDGGLKEFITWKIGTLVSIVRQHIRKYLQDILSLVSELWISSFSLPAPKRTIQGPQ
ASPVLHLVEQLCLALNDEFRMYLLHILPSCIQVLGDAERCNDYYHVPDILHTLEVFGGNL
DEHMHLVAPVLVRLFKVELVDIRRRAIVTLTKLIPRVQVGTHVSALVQHLKLVLDGNNDD
LRKDAAEALCSLAHALGEEFTIFIPSIRKLLVKHHLRYRKWDEIENRLLRREPLISDNMS
VQKYTQCPPDVISDPLDDVDGVPSEEADETQRQPGSHRVNDVRLRSAGEASQRSTRDDWT
EWMRHFSIALLKESPSPALRTCARLAQLQPSVGRELFAAGFASCWAEMTESSQEQLVRSL
KTAFSSQNIPAEILATLLNLAEFMEHDEKPLPIDTRLLGALAEKCRAYAKALHYKEMEFE
AVFSKKMGANPVTVVESLIHINNQLHQHEAAIGILTYSQQHLEVQLKESWYEKLHRWDEA
LRAYTVKSSQASGPLQNLDATLGRMRCLASLARWEDLSTLCREQWTGAEQSARLEMAPMA
ANAAWHMGEWEQMSEYVSRLDDGDENKLRLLGNTTASGDGSSNGAFFRAVLSVRCKKYEE
ARVYVERARRCLATELAALVLESYERAYNNMVRVQQLSELEEVIDYCTLPTESPIADGRR
ELIRNMWNERIKGTKRNVEVWQALLAVRELVLPPNEDRDTWIKFAKLCWKSGRISQAKST
LVKLLQFDPESSPELTLYHGHPQVVLAYLKYQYAVGDELKRKDAFSRLQDLSVQIATATN
SYPGTLVSQGAVSSAGVPLIARVYLTLASWKRALSPGLDDDAIQEILVSYKNATLSAKDW
GKAWHSWALFNTEVMSRYTLRGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILR
LLTLWFNHGATSEVQMALQKGFSLVKIEMWLVVLPQIIARIHSNNRIVRELIQALLVRIG
KGHPQALMYPLLVACKSISILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHE
MWHEALEEASRMYFGEHNIEGMLAVLEPLHAMLERGAETIKENTFIQAYGHELLEAHECC
LKYRATGEDAELTKAWDLYYHVFRRIDKQLPSLTTLDLHSVSPELLKCRKLELAVPGTYS
ADSPLVTIEYFVPQLIVITSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLV
NTLLENSRKTSEKDLSIQRYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEH
RLMLAFAPDYDHLPLIAKVEVFEHALQNTEGNDLAKVLWLKSRTSEIWLERRTNYTRSLA
VMSMAGYLLGLGDRHPSNLMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVK
AMEVSGIEGTFRTTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQVSNYGN
AHTQPVVSSEETAPNEELMPPLRGAREKELLQAVNQLGDANEVLNERAVAVMARMSHKLT
GRDFSSGSALSGAGSSNQHGNEHLASVDARDVEPGLSVKVQVQKLILQASSHENLCQNYV
GWCPFW
Download sequence
Identical sequences I1HK91
XP_003568625.2.954 EG:BRADI2G28007.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]