SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G28137.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G28137.1
Domain Number 1 Region: 533-840
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-69
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 69-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-23
Family alpha-D-mannose-specific plant lectins 0.0019
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G28137.1
Domain Number - Region: 368-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0157
Family Anti-platelet protein 0.027
Further Details:      
 
Domain Number - Region: 262-294
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.038
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G28137.1   Gene: BRADI2G28137   Transcript: BRADI2G28137.1
Sequence length 846
Comment pep:novel chromosome:Brachy1.0:2:27389554:27392094:1 gene:BRADI2G28137 transcript:BRADI2G28137.1
Sequence
MTPAPPSCFLLLLVLLTASSLPRPPAVVAARESLARGASIAVEDHATNILRSPNGAFACG
FYAVSPTVFTFSIWFARARNRTVVWTAAPAHPVHSQGSRVALDKRGGPLVLTDFNGEPVW
SSASSTTAAAASRAVLRDSGNLVVEDAAGRALWQSFDFPTDTLLPTQRLTATTRLVSSGS
GYYSLGFSDYAMLSLFYDNGNFSSIYWPNPYNNYVANNRRIYNFTRVAAMDARGSFLSSD
NANFLAADLGVATGEYGQVMRRLTLDADGNLRLYSLQNATWAVTWMAFGNPCTIHGVCGA
NAVCLYTPAPACACAPGHERADTRDWSRGCRPAFRLQPHELCPRQPRGTKLVALPHSDFW
GYDLNAGEILPLAECTRWCMENCACVGFQHKEHDMECYLKSVLFNGRTFPGLTGTVYIKV
PADFHVPGFRIHQWQPHGAGLAIDEDNISTGCRAPNDQELVVLVNVSDASSKKNAVDAKP
VWPYLYGFLSALLVVEAAAIGLGWWLFFSKNGPLTAASSSSPVYPVDEGYKLILLTAHFR
RYSYAAIKKATGDFAADRVLGRGGSGVVYKGVLDDGRPVAVKALTTVSGRRWISEEEFQA
ELGAIGQIYHMNLARVVGCCSHGARRFLVSELVENGSLAAGLFEGGGNGVLLGWRQRFRI
AVGVARGLAYLHTECLQRIVHCDMKPENILLDRDMEPKIADFGLAKLLDRVGNNGPSSGR
PTKDMSSRGTRGTRGYMAPEWVTSVAVTDKVDVYSFGVVLLELVRGARLQGADDEGGRDT
DVPAVREMTRSGAGVESLVDGRLAGEFSRAQVRAVVGVALSCLEEDRSRRPSMSSVVQAL
VSVEDA
Download sequence
Identical sequences I1HKB0
XP_003566343.1.954 EG:BRADI2G28137.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]