SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G31490.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G31490.1
Domain Number 1 Region: 502-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-79
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G31490.1
Domain Number - Region: 72-192
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00323
Family delta-Endotoxin, C-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G31490.1   Gene: BRADI2G31490   Transcript: BRADI2G31490.1
Sequence length 878
Comment pep:novel chromosome:Brachy1.0:2:31238510:31241471:-1 gene:BRADI2G31490 transcript:BRADI2G31490.1
Sequence
MGFPILLVIILTLLSLILLVVVADNNSTASGHVALNCGASGQNNDDNGRTWDGDTSSKFA
PLVKGVTAPASYQHPSLPSTVPFMTARIFTSNYTYSFPVSAGRMFVRLYFYPIAYGNYAV
SDAFFSVTTRNLSLLNDFNASQTAQAINVAYLVREFSLNVSSGSLDLTFAPSKHWNGSYA
FVNGIEIVPTPDIFTTADTRFVNGGTPAPFQINTDRGFQTMHRLNVGGQAIPPKDDLSFY
RSWANDSPYIFGGSGVAFSRDNNLTIKYTSTVPNYTAPIGVYGTARSMGTNAQVNLNYNL
TWILPVDAGFFYLLRFHFCEIQYPITKVNQRSFFIYINNQTAQRQMDVIAWSGGIGRTAY
TDYVIITTGSGQVDMWVALYPDLSSKPEYYDAILNGLEVFKLQDYGKNNLAGLNPPLPQK
PDVNPNGPSREGNSRGTVLAAICGAIGGFAVLLICFGVCIACRRNKKISKDSDKSDDGCW
TPLADYSRSRSGNSGNTATTGSHASLPSNLCRHFSFAEVQAATNNFDQAFLLGKGGFGNV
YLGEIDSGTKLAIKRCNPMSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCEDKNEMILVYD
YMAHGTLREHLYKTKNPPLSWKQRLEICIGAARGLHYLHTGVKQTIIHRDVKTTNILLDD
KWVAKVSDFGLSKTGPNVDNTHVSTVVKGSFGYLDPEYFRRQQLSEKSDVYSFGVVLFEV
LCARPALSPSLPKEQVNLADWALHCQKKGILGQIIDPLLQGKISPQCFVKFAETAEKCVA
DHSIDRPSMSDVLWNLEFVLQLQESAEDNSSLTGGMSSSDVSSPLVPTRLQSDEPSTETT
TTTTASTMSITQRSIASAESAGLTPSTIFSQLMNPDGR
Download sequence
Identical sequences I1HKP3
EG:BRADI2G31490.1 15368.BRADI2G31490.1 XP_003568697.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]