SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G32627.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G32627.1
Domain Number 1 Region: 48-108
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000111
Family Variant RING domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G32627.1   Gene: BRADI2G32627   Transcript: BRADI2G32627.1
Sequence length 171
Comment pep:novel chromosome:Brachy1.0:2:32573153:32574762:1 gene:BRADI2G32627 transcript:BRADI2G32627.1
Sequence
MVITAGREGSVVEDGAAAHVVVEVHRSAAAAAAADDDQLQQQELGGTGSSGCRICHLEDG
DLPEESGGGKLVSLGCGCRGEIAAAHRRCAEAWFSVKGNRRCEICGQNAANIIGRGGGGK
EFMQQWHGTAAAAEGSSKATGFCRSQTFCNLLIACLIIVFVLPWFFHNHMI
Download sequence
Identical sequences I1HKY3
XP_003566428.1.954 EG:BRADI2G32627.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]