SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G33980.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G33980.1
Domain Number - Region: 59-189
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0445
Family CAT-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G33980.1   Gene: BRADI2G33980   Transcript: BRADI2G33980.1
Sequence length 434
Comment pep:novel chromosome:Brachy1.0:2:34057152:34059364:1 gene:BRADI2G33980 transcript:BRADI2G33980.1
Sequence
MAAAAAAKPVPVERLAQRLVAPAGPTPEGPLRLSWLDRYPTQMALIESLHVFKPDMAREG
DSPARAVERALARALVDYYPLAGRLAVSDAGELQVDCRDGGVWFIEAAVRCRLEDVDYLE
YPLAVDKDELLPHPRPKPTHEEESKLILLVQVTTFDCGGFVVGFRFSHAVADGPGAAQFM
GAVGELARGAGRISVPPAWGRDAIPDPAGALVGRLPEPAGAKRLEYLAIDISADYINHFK
AQFAAATGGARCSAFEVLIAKAWQSRTRAAGFDEESPVHLSFAMNARPLLHARLPSGGAG
FYGNCYYIMRVSSTAGKVASSSMADVVKIIKEGKKRLPSEFARWAAGEMAGVDPYQITSD
YRTLLVSDWTRLGFAEVDYGWGPPAHVVPLTNLDYIATCILVKPWAHKPGARLITQCVTP
DRVAAFHDAMVDTN
Download sequence
Identical sequences I1HL91
XP_003568810.1.954 XP_010231650.1.954 15368.BRADI2G33980.1 EG:BRADI2G33980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]