SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G34630.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G34630.1
Domain Number 1 Region: 65-159,191-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-30
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G34630.1
Domain Number - Region: 332-380
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000114
Family Hairpin loop containing domain 0.077
Further Details:      
 
Domain Number - Region: 436-504
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0102
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G34630.1   Gene: BRADI2G34630   Transcript: BRADI2G34630.1
Sequence length 516
Comment pep:novel chromosome:Brachy1.0:2:34692565:34694982:1 gene:BRADI2G34630 transcript:BRADI2G34630.1
Sequence
MPLVSIIFVFLLPTLHTPACSAARSAISAHEVLTGSEKLVSRNGKFALGFFQQGSEYSQQ
TPSHWYLGIWFDKIPKLTPLWVANRESPIINLEMLELTISDDGNLVILNQATKLTIWSTH
ANITAKNTTVVLLDNGNLILGDPSNSSDIMWQSFDYPTDGLLPGAKQGLDKVTGLNRRLI
SKKSLIDPAPGRYCVELDTTGPGQFLYKLCNSSIVYWSSGEWNGHYFNSLPEMSGGNLFK
FEFVNNNKEAYFRKYLVDDRLRTTSVLDISGQEKQLIWVDSSQDWMTVFTQPRDRCDVYA
TCGPFTIYRSGGCIRNTPLDCGTRNQSRNATTDKFYSMTGITLPAMSIVIEAVGSIDRCA
RACLDNCSCIAYSYGTRCSLWYDELLNIKNGNTGSTSDGEVLYLRISAKDAESWRNKKRA
KKEVIGAITAGGVVALVASKLIEGDVSSLLDDKLLGDVEIHEAERVCKVACWCIQDEESN
RPTMGEVVQILEGLLELEVPPMPRLLQAIVGTSKRY
Download sequence
Identical sequences I1HLG7
EG:BRADI2G34630.1 15368.BRADI2G34630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]