SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G35620.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G35620.1
Domain Number - Region: 51-93
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000324
Family Ribosomal protein S4 0.053
Further Details:      
 
Domain Number - Region: 174-201
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0521
Family Ribosomal proteins L24p and L21e 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G35620.1   Gene: BRADI2G35620   Transcript: BRADI2G35620.1
Sequence length 265
Comment pep:novel chromosome:Brachy1.0:2:35943443:35946281:1 gene:BRADI2G35620 transcript:BRADI2G35620.1
Sequence
MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE
VQSILMQRQILVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDSK
FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV
VMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTKPWVSLPK
GKGIKLTIIEEQRKRDAAAQAAAKA
Download sequence
Identical sequences I1HLR2
15368.BRADI2G35620.1 XP_003568916.1.954 EG:BRADI2G35620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]