SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G36670.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G36670.1
Domain Number - Region: 106-204
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.001
Family NRPS condensation domain (amide synthase) 0.041
Further Details:      
 
Domain Number - Region: 235-242
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G36670.1   Gene: BRADI2G36670   Transcript: BRADI2G36670.1
Sequence length 457
Comment pep:novel chromosome:Brachy1.0:2:36983887:36985260:1 gene:BRADI2G36670 transcript:BRADI2G36670.1
Sequence
MGSLDVAKESLHSTAPKQQLTFAVRRRVAELVCPAVATPRETKRLSDIDDQDTLRGHVRF
ALFYRGGSQKQDDDPVGVIRRALAEALVPYYPLAGRLREVVARKLVVDCAGQGVLFVEAD
ADVRLAEIQAAGPLTPPFPCMDQLLFDAQGSDGILNAPLLLIQVTRLLCGGFVFALRLNH
TVCDAIGIVQFMGAVAELARGLPSPTVNPAWSRELLEARSPPSPSFPHREYDLLPPPPPP
PPSDMVLRTFSFSSGNIATIKKRLGDDKSTTFEALAAALWLARTAALEIPAGELARLVVI
ANFRPIAAGPDPGLGLPAGYYGNACVPPTALADAGELTTSSSAMSLREAAALVRGAKAAV
TADYVRSTADVLAERGRPCLALDNLLVVSDLRHAGFRGVDFGWAGPVYGGPADTVFGVCF
FVAVKGEDGEEAVAVPVVLPRIAMDRLAKEVERLCQA
Download sequence
Identical sequences I1HM35
XP_010231737.1.954 15368.BRADI2G36670.1 EG:BRADI2G36670.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]