SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G37586.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G37586.1
Domain Number 1 Region: 17-67
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000497
Family Protein kinases, catalytic subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G37586.1   Gene: BRADI2G37586   Transcript: BRADI2G37586.1
Sequence length 112
Comment pep:novel chromosome:Brachy1.0:2:37948138:37951008:-1 gene:BRADI2G37586 transcript:BRADI2G37586.1
Sequence
MALELYSTVTLRRGEKKHHTNKVDVYSFGIVLWELLTNKMPFEGMSNLQAAYAAAFKVSL
SARNTLPYLTFQGMTLVKPQPDRRQLSAVSHGSLSVPPSRLARTIDSSRVTW
Download sequence
Identical sequences I1HMF1
EG:BRADI2G37586.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]