SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G38200.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G38200.1
Domain Number 1 Region: 494-790
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-54
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 99-317
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000000207
Family beta-lactamase inhibitor protein-II, BLIP-II 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G38200.1   Gene: BRADI2G38200   Transcript: BRADI2G38200.1
Sequence length 840
Comment pep:novel chromosome:Brachy1.0:2:38556042:38558994:1 gene:BRADI2G38200 transcript:BRADI2G38200.1
Sequence
MTPAPTVHLPALLIPFLLVLLLLAGGASASTLAVSAGSAVCAVASENGTLYCAVPALPNA
TANASSSSAQPVAPSLVFSRVSGGAGFLCALGTARGSGVGDSVDRALLCWPPTDPGSLRR
VYRGAATLADLAVGDTHVAAYDAQARGIRWWRRGSDQSQSQFPELVLGAFRSIVSGDGFT
CALETTNSSGDSKVRCWGPQGSAVEAAFANATSVSSLAAGGSRACGVEEGSGGQVICSGS
GAGALAQTGIYPHGLAVGDSHACGLLRPNHTAVCWSLAGPTPTLYYPAYGTPFELLVAGG
NLTCGLVSTNFTVECWSSSSSSVAVELPLPPVLPGACVPDGSSCACGVLERSAELCAGSG
GGVICKRLCELSPPPASPPPQSPPPAEAPSKGVSKGWIAFAAVGAVGAFIGLCSLVYCFV
FGFCSHKRIHNSVQPNLPGAPAIAAAAADTNVGVAASPYGSPNGSRARGVGGGGGLFLRR
QLSRAMTRQRSGPSSFKESTEEYTFAQLSAATGGFAPEAKIGEGSFGAVYRGKLPDGREV
AIKRAGDSPARRFQEKESAFRSELAFLSRLHHKHLFMKNGALYDHLHPKLDSPSSSPSPV
VASWRLRIKILLDASRGIDYLHSYAVPPIIHRDIKSSNILLDGNWVARVSDFGLSLMGPP
ETEETTAAAAAPQHYMKAAGTVGYMDPEYYGLHHLTVKSDVYGFGVVMLEALTGKRAIFK
DADEGAPVSVVDYAQPSIVAGELGKVLDGRAPEPTPHEAEAVELVAYTAVHCVRLEGKDR
PAMADIVANLETAFALCEGSAGGSRGRGSGNGAGGGGFGNSSSSASISLTSMELSGRRED
Download sequence
Identical sequences I1HMM6
EG:BRADI2G38200.1 15368.BRADI2G38200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]