SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G40030.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G40030.1
Domain Number 1 Region: 499-838
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-82
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 291-480
Classification Level Classification E-value
Superfamily ARM repeat 1.15e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00016
Further Details:      
 
Domain Number 3 Region: 82-190
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.14e-25
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G40030.1
Domain Number - Region: 251-293
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.0104
Family MHC antigen-recognition domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G40030.1   Gene: BRADI2G40030   Transcript: BRADI2G40030.1
Sequence length 846
Comment pep:novel chromosome:Brachy1.0:2:39994420:40001111:1 gene:BRADI2G40030 transcript:BRADI2G40030.1
Sequence
MTATAGGRTSTAAAGNNEFRFFLSCDISLPLTFRVIQAPIPPPTTTTQGHPHHPLLCPLN
SLFSSDESFPIAPDGLDKKVPELFVECKLFIDGIQFGLPVNTRLESSGPPYCWNELITLC
TKYRDLTSLAQLAFTVWDVSSGDGRNVVGGATIFLFNNKKQLKTGRQKLRLWPQKEADGG
VPTTTPGKVPKNERGEIERLERLVNKYERGQIHHVDWLDRLAFTAVDKVKEKECERLENL
FPSLVVEFCSFEHRVVFQESGTNFYAPAPVLLSNEVVTVWDPELGRTNPSEHKQLKLARS
LTRGIIDRDLKPSSNERKLLQRVIKYPPTRAILPDEKQLVWKFRFSLMSEKKALTKFVRS
VDWSDIQEAKQAVELIGKWETIDVADALELLSPDFESEEVRAYAVSVLERADDEELQCYL
LQLVQALRFERSDKSRLAHFLVNRALSNIEIASFLRWYVVVELHDHAYARRYYSTYDMLE
DEMMKMVAREDGDEDGFRLWQSLSRQTELTAQLCSIMKDVRNVRGSAQKKIEKLRQLLSG
VFSELTNFDEPIRSPLAPTLLLTGVVPQESSIFRSALNPLRLTFKTANGGTSKIIFKKGD
DLRQDQLVIQMVSLMDRLLKLENMDLHLTPYRVLATGQDEGMLEFIPSSSLAQILSEHRT
ITSYLQKFHQDEEGPFGITAQCLETFIKSCAGYSVITYIMGVGDRHLDNLLLRDDGCLFH
VDFAFILGRDPKPFPPPMKLCKEMVEAMGGTESQYYTRFKSYCCEAYNILRNNSSLILNL
FKLMGRSNIPDISNEENGSLKLQEKFRLDLNDEEAIHFFQDLINESVSALFPQMVETIHR
WAQYWR
Download sequence
Identical sequences I1HN93
15368.BRADI2G40030.1 EG:BRADI2G40030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]