SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G40760.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G40760.1
Domain Number 1 Region: 230-515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-75
Family Tandem AAA-ATPase domain 0.0000511
Further Details:      
 
Domain Number 2 Region: 8-49
Classification Level Classification E-value
Superfamily WW domain 0.000000054
Family WW domain 0.0032
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G40760.1
Domain Number - Region: 54-64,218-230
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00889
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G40760.1   Gene: BRADI2G40760   Transcript: BRADI2G40760.1
Sequence length 828
Comment pep:novel chromosome:Brachy1.0:2:41077094:41081929:1 gene:BRADI2G40760 transcript:BRADI2G40760.1
Sequence
MAGTAAPRYAPDDPTLPKPWRGLVDGTTGYLYYWNPDTNITQYEKPLLPEDQLPPPPPLP
PPPPRSRGRRDRSRSRSRDRRDRSRSRSRSRTPPRRDHRDRDRDRRRHDEHNSSKQASSY
HQLPPVVPTAAPDDPSAEAYRRRHEITVIGDNVPAPITAFDSGVIPSDILKEIQRAGFPS
PTPIQAQSWPIALQNQDVVAIAKTGSGKTLGYLLPGFMHIKRLQNSTRSGPTVLVLAPTR
ELATQILEEAVKFGRSSRISSTCLYGGAPKGPQLRDLERGVDVVVATPGRLNDILEMRKI
SLKQVSYLVLDEADRMLDMGFEPQIRKIVKDIPSSRQTLMYTATWPKEVRRIADELLVHP
VQVTIGSVDELVANKAITQHVEVITPSEKLRRLEQILRSHDSGSKILIFCTTKRMCDQLS
RTLNRHFGAAAIHGDKSQNEREKVLSQFRSGRSPILVATDVAARGLDIKDIRVVINYDFP
TGVEDYVHRIGRTGRAGATGLAYTFLCDQDAKYAADLIKILEGADQDVPRELMDMVSRGG
RGRKRNKWATRSERGGGSRSELDSSRYSGRLESSRSGRGKDDYSGRGRHDYGGSDGRSRR
SGRGRSRSRSRSDSDRRSPSPKRRRHDGLKSRSRTRSRSRSRSRSRSRSYTRNRRASRSR
SRSPAARHRTERRDGSATARPDSGHRVEHKTSPRVHPSNDHTKHSGSPKVHPSNDHTNHS
DQKDDYHLEDGKMGKVDLDRSPSPQDDKSAPYSPVYSKGKDSMSPIGQPVVEAKAVEVSQ
KPDPASPPHRSKNRDDEEEGIIDEEGEEGMIADDDPRASAAVQNGGEK
Download sequence
Identical sequences I1HNG4
XP_003566767.1.954 EG:BRADI2G40760.1 15368.BRADI2G40760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]