SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G41480.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G41480.1
Domain Number 1 Region: 198-471
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.07e-106
Family BC ATP-binding domain-like 0.00000000803
Further Details:      
 
Domain Number 2 Region: 756-1018
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.72e-100
Family BC ATP-binding domain-like 0.000000312
Further Details:      
 
Domain Number 3 Region: 466-624
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 6.28e-53
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000595
Further Details:      
 
Domain Number 4 Region: 626-758
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.31e-46
Family BC N-terminal domain-like 0.00000267
Further Details:      
 
Domain Number 5 Region: 76-197
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.6e-44
Family BC N-terminal domain-like 0.00000637
Further Details:      
 
Domain Number 6 Region: 1020-1157
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.49e-32
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G41480.1   Gene: BRADI2G41480   Transcript: BRADI2G41480.1
Sequence length 1172
Comment pep:novel chromosome:Brachy1.0:2:41705793:41710727:1 gene:BRADI2G41480 transcript:BRADI2G41480.1
Sequence
MATSLSSHSQLRPCPSHAHRQTVLSRSLLPFPRRHHHGSSRRGLSARASSNGAAQDPSVT
VRHFAAEPTKGGKLAGVKKIMILGAGPIVIGQACEFDYSGTQACKALVEEGYEVVLVNSN
PATIMTDPDLAHRTYIGPMTPPLVEGIIAQERPDALLPTMGGQTALNLAVSLAESGALDR
LGVRLIGASLPAIRAAEDRQLFKQAMDRIGLKTPPSGIGTTLEECLSIAKDIGEFPLIVR
PAFTLGGTGGGIAYNRAEFEDICRSGLAASHTQQVLVEKSLLGWKEYELEVMRDMADNVV
IICSIENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDHSVAIIREIGVECGGSNVQFAVN
PADGEVMVIEMNPRVSRSSALASKATGFPIAKMAAKLSVGYTLDQIPNDITKKTPASFEP
SIDYVVTKIPRFAFEKFPGSEPILTTQMKSVGESMALGRTFQESFQKAVRSLETGFAGWG
CAPVKELDWDWEKIKYSLRVPNPERIHAIYAAFKKGMRVEDIHEISFIDKWFLTELKELV
DVEQFLISRNLDQLSKDDFYQVKRRGFSDKQIAFATSSSESDVRARRSALGVTPTYKRVD
TCAAEFEANTPYMYSSYEYECESAPTSRKKVLILGGGPNRIGQGIEFDYCCCHASFALRE
AGYETIMMNSNPETVSTDYDTSDRLYFEPLTVEDVTNVIDLERPDGIIVQYGGQTPLKLA
LPIQRHLEETKLRSASGTGFVKIWGTSPDSIDAAEDRKRFNAILEELGIEQPKGGIARSE
SDALSIASEVGYPVVVRPSYVLGGRAMEIVYNDEKLIKYLATAVQVDPERPVLVDKYLND
AIEIDIDALADSVGNVVIGGIMEHIEQAGIHSGDSACSLPTRTVSTQCLDIIRSWTTKLA
KRLNVCGLMNCQYAITPTGEVFLLEANPRASRTVPFVSKAIGHPLAKYASLIMSGVTLPE
LRFTKEVIPKHVSVKEAVLPFEKFQGCDILLGPEMRSTGEVMGIDYEFSGAFAKAQIAAG
QKLPLSGTVFISLNDLTKRHLAEIGRGFRELGFNIVSTSGTAKVLQLEGIPVDPVLKIHE
GRPNARDMLKNGQIQVMVITSSGDDLDSRDGLQLRRLALAYKVPIITTVDGARATMDAIK
SLKNKSIEILALQDYFQPADAPQDLQAARATS
Download sequence
Identical sequences I1HNQ9
EG:BRADI2G41480.1 XP_003569229.1.954 15368.BRADI2G41480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]