SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G41610.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G41610.1
Domain Number 1 Region: 220-482
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-68
Family Extended AAA-ATPase domain 0.0000000827
Further Details:      
 
Domain Number 2 Region: 470-657
Classification Level Classification E-value
Superfamily FtsH protease domain-like 8.24e-68
Family FtsH protease domain-like 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G41610.1   Gene: BRADI2G41610   Transcript: BRADI2G41610.1
Sequence length 704
Comment pep:novel chromosome:Brachy1.0:2:41907038:41913126:1 gene:BRADI2G41610 transcript:BRADI2G41610.1
Sequence
MAWRRVLSQAARNQSAYAIYNELAAPSPLRSLRSNISAGGTLRNLHERYYSSYFGSLSRS
ARDLGSPSEASLLKEIYRSDPERVIQIFEGQPSLHSNPSALSEYVKALVKVDRLDESILL
KTLQRGVAASERAEGSLSSVPALKSAGQVTKDGIIGTANAPIHMVTAETGQFKEQLWRTF
RSIALTFLLISGIGALIEDRGISKGLGLNEEVQPSMESSTKFSDVKGVDEAKAELEEIVH
YLRDPKRFTRLGGKLPKGVLLVGPPGTGKTMLARAIAGEASVPFFSCSGSEFEEMFVGVG
ARRVRDLFAAAKKRSPCIIFMDEIDAIGGSRNPKDQQYMKMTLNQLLVELDGFKQNEGII
VIAATNFPESLDKALVRPGRFDRHIVVPNPDVEGRRQILESHMSKVLKSDDVDLMIIARG
TPGFSGADLANLVNVAALKAAMDGAKSVTMNDLEYAKDRIMMGSERKSAVISDECRKLTA
YHEGGHALVAMHTDGAHPVHKATIVPRGMSLGMVAQLPEKDETSVSRKQMLARLDVCMGG
RVAEEIIFGDSEVTSGASSDFQQATSMARAMVTKYGMSKQVGLVSYNYEDDGKTMSSETR
LLIEEEVKSFLEKAYNNAKTILTKHNKELHVLANALLEHETLSGAQIKKILAQVNNKQPQ
EHAIEAPQKTQTSPSSPAAAAAAAAAAAAQQAAAKAQGVAGIGS
Download sequence
Identical sequences I1HNS4
15368.BRADI2G41610.1 EG:BRADI2G41610.1 XP_003569240.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]