SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G41696.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G41696.1
Domain Number 1 Region: 400-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.95e-48
Family Protein kinases, catalytic subunit 0.00031
Further Details:      
 
Domain Number 2 Region: 31-151
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000454
Family Polygalacturonase inhibiting protein PGIP 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G41696.1   Gene: BRADI2G41696   Transcript: BRADI2G41696.1
Sequence length 698
Comment pep:novel chromosome:Brachy1.0:2:42079109:42082619:-1 gene:BRADI2G41696 transcript:BRADI2G41696.1
Sequence
MASARLVALAVMAAVVCCSLPGPASAADDGEVRALLELKAALDPTGRLLPSWAPGRDPCG
GGGGGFEGVACDARGGVANLSLQGKGLSGTLSPAVAGLRALTGLYLHYNALRGAVPRELT
GLSQLTDLYLDVNNFSGAIPPEIGTMASLQAVLQSADREHPHAAGAPQQADGACSAVQPP
QWRHPRQPRRPARADAAGLELQPPLRLHPGAAGQAASARGFRCQEQLAHRQRARRIGELE
GGFQYGNNTDLCGTGLPDLRPCTPADLIDPDRPQPFSAGIAPDITPGSSSDAGRGHCSGT
HCPPSTKALAAAVVVAVVILAATAAGLFAFSWYRWRKQRTAGAAAGAPPAPAGGRCSTEA
TKEPSSFRKSASSTLVSLEYSNGWDPLSDGRSGAGFSKEVSPSLRFNMEEVESATQYFSE
LNLLGKKKNRKSSASVSKATYRGTLRDGTPVVVTRLGKTCCKQEEAEFLKGLKLLAELRH
DNVVGLRGFCCSRARGECFLVHDFVPNGSLSQFLDVHNGGGGAPGHGGHVLEWSTRVSII
NGIAKGIEYLHSSRANKPPLVHQNISADKILVDYTYKPLISGSGLHKLLVDDLVFSTLKA
SAAMGYLAPEYTTVGRFSEKSDVYAFGVIVFQILTGKRKTMQLPFEFGNADELIDSNLKG
CYSLTEATKLAKIALVCTSENPDQRPTMEELIKELGTL
Download sequence
Identical sequences I1HNT4
EG:BRADI2G41696.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]