SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G43110.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G43110.1
Domain Number 1 Region: 375-640
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-52
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 25-214
Classification Level Classification E-value
Superfamily L domain-like 1.17e-34
Family Polygalacturonase inhibiting protein PGIP 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G43110.1   Gene: BRADI2G43110   Transcript: BRADI2G43110.1
Sequence length 675
Comment pep:novel chromosome:Brachy1.0:2:43602944:43608572:-1 gene:BRADI2G43110 transcript:BRADI2G43110.1
Sequence
MARAVVLVAVVASLACLAWAEPPASERSALLAFLTATPHERRLGWNASTPACGWVGVTCD
AANSTVVQLRLPGVGLVGAIPPATIGRLTNLQVLSLRSNRIFGAIPDDLLQLSSLRSMFL
QNNLISGAIPAGVNKLAALERLVLSHNNLSGPIPFALNSLTKLRAVRLEGNRLSGKIPSI
SIPGLTAFNVSDNNLNGSIPQPLSRFPADSFSGNLQLCGKPLPACTPFFPSPAPAPGMSP
GDEPVPASGKKRKLSGAAIVGIVVGAVVAALLLLALIVFCVVSRRRRAAGSTREGPKGTA
AAVGQTRGVAPPASGDGTGMTSSSKEDMGGGTSGSVAAAAVAAGAGTGEPSRLVFLGKGA
GYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVAVARREFDAHMDALGR
VEHRNVLPVRAYYFSKDEKLLVYDYLPTGSLSAMLHGSRGSGRTPMDWDARMRSALSASR
GLAHLHSAHNLVHGNVKSSNVLLRPDYDAAALSDFCLHTIFAPTSSRAGAGGYRAPEVVD
TRRPTFKADVYSLGVLLLELLTGKSPTHASLEGDGTLDLPRWVQSVVREEWTAEVFDVEL
VRLGASAEEEMVALLQVAMACVATVPDARPDATDVVRMIEEIGGGHGQTTTEESARGTTS
EEERSRGTPPAAPTP
Download sequence
Identical sequences I1HP99
15368.BRADI2G43110.1 EG:BRADI2G43110.1 XP_003566864.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]