SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G43910.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G43910.1
Domain Number 1 Region: 73-343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-84
Family Protein kinases, catalytic subunit 0.00000243
Further Details:      
 
Domain Number 2 Region: 371-512
Classification Level Classification E-value
Superfamily EF-hand 1.56e-46
Family Calmodulin-like 0.0000241
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G43910.1
Domain Number - Region: 17-50
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G43910.1   Gene: BRADI2G43910   Transcript: BRADI2G43910.1
Sequence length 526
Comment pep:novel chromosome:Brachy1.0:2:44420445:44424115:1 gene:BRADI2G43910 transcript:BRADI2G43910.1
Sequence
MGNRTSRHRRAAAAEQPTPVPSPPPAQPKPEPQQQTLHWPQPKPQPPPAPAVEAGVVAMG
RVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIEDVQ
REVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAVLCR
EMVSVVHSCHSMGVFHRDLKPENFLFLNNKEDSPLKATDFGLSVFFKHGEQFKDLVGSAY
YVAPEVLKRHYGAEADIWSAGVILYILLSGVPPFWADNEDGIFKAVLLGHIDFSSDPWPS
ISNPAKDLVKKMLRQDPKERLTAAEILDHPWIKEDGEAPDKPLDITVISRMKQFRAMNKL
KKVALKIVAENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLM
EAADVDGNGTIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYD
MGDDKTIKEIIAEVDTDNDGRINYQEFVAMMRNNSPEIVPNRRRMF
Download sequence
Identical sequences I1HPI9
XP_003569386.1.954 EG:BRADI2G43910.1 15368.BRADI2G43910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]