SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G46080.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G46080.1
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-16
Family Splicing factor U2AF subunits 0.0058
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G46080.1
Domain Number - Region: 149-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000235
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 16-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000288
Family CCCH zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G46080.1   Gene: BRADI2G46080   Transcript: BRADI2G46080.1
Sequence length 281
Comment pep:novel chromosome:Brachy1.0:2:46511227:46514632:-1 gene:BRADI2G46080 transcript:BRADI2G46080.1
Sequence
MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRIHNRPTISPTIVLMNMYQRPDMITP
GVDAQGQPIDPRKMQEHFEDFYEDIFEELSKFGEIETLNVCDNLSDHMIGNVYVQFREED
QAAAAHTALQGRFYSGRLIIVDFSPVTDFREATCRQYEENTCTRGGHCNFMHVKQIGKDL
RKKLFGRYRRSHRGRSRSPSPHHRRERRDRDDYRGRDDYRRGGGGGGGGRRGGSSRNERH
DDGGRRRYGGSPPRRARSPVRENSEERRAKIEQWNREKEAK
Download sequence
Identical sequences I1HQ79
EG:BRADI2G46080.1 XP_003569529.1.954 XP_010232117.1.954 XP_010232119.1.954 XP_010232120.1.954 XP_014755195.1.954 15368.BRADI2G46080.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]