SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G46340.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G46340.1
Domain Number 1 Region: 521-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-80
Family Protein kinases, catalytic subunit 0.000012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G46340.1
Domain Number - Region: 180-238
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.017
Family Arylamine N-acetyltransferase 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G46340.1   Gene: BRADI2G46340   Transcript: BRADI2G46340.1
Sequence length 802
Comment pep:novel chromosome:Brachy1.0:2:46786767:46795821:-1 gene:BRADI2G46340 transcript:BRADI2G46340.1
Sequence
MDEAPTSSGQSEATSCEPSWWPPDLLDKIESVAISRKQEVLVDKESRIILANSRSSSWKA
SQLLWSTGTYSGFIPNGFYSIIPDKKLKECFPTIPSLNELQTLEADGLRTDIIVVDAEKD
KKIFMLKQLSAALVKGLNSSPALVIKKIAGLVFDCFKGQNPDVSPGRAATEDTHFFGNKG
PQLLGQIRHGSCRPRAILFKVLADAVGLESKLVVGLPDDGADGFVDSYKHMSVVVPLNSM
ELLVDLMRFPGQLIPFSAKAIFTSHISAAGESDSAENDSCDSPLEPNSPLYGLSDKVEAE
GIEASSNLSGRSLRNTMLRSRTFSEGKLSTSCSEPNIANAFWRRSQRKGVAEEPRCASSS
PEHPLMRAKGRSILSGERQSFQEYTDGVTSRSDDPGGTTIPTPRRIRRRSISITPEIGDD
IVRAVRAMNETLKQNRLQRDHVNDGSCSYISEDTSNAHDCPNKDDKSGRDVATNNGLRNR
TCSTQKAMSLPTSPHDYEGGISETSDNCDFISKEKMVFAWNKVLQSSPFNKPLLPFQEWN
IDFSELTIGTRVGIGFFGEVFRGIWNGTDVAIKVFLEQDLTTENMEDFCNEIYILSRLRH
PNVILFLGACMVPPHLSMVTEYMEMGSLYYLIHMSGQKKKLSWRRRLKIIRDICRGLMCI
HRMKIVHRDLKSANCLVNKHWTVKICDFGLSRAMTDSPMTDNSSAGTPEWMAPELIRNEP
FSEKCDIFSLGVIMWELCTLSRPWDGISPVQVVYAVANEGSRLEIPEGPLGKLIADCWAE
PQDRPSCQEILTRLLDCEYSTS
Download sequence
Identical sequences I1HQB0
EG:BRADI2G46340.1 15368.BRADI2G46340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]