SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G47850.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G47850.1
Domain Number 1 Region: 5-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-85
Family Protein kinases, catalytic subunit 0.000000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G47850.1   Gene: BRADI2G47850   Transcript: BRADI2G47850.1
Sequence length 471
Comment pep:novel chromosome:Brachy1.0:2:48211458:48216976:1 gene:BRADI2G47850 transcript:BRADI2G47850.1
Sequence
MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ
GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTGTARYA
SVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKCATSIEAL
CRGYPTEFTSYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGFQFDYVFDWTILKYQQSQI
ASAPPRVGGHAAGPSGLTPPALLQNDSQSGAVDGRISGWSAMDRRRAPPPIASVGTLTKQ
KAPVGNDAPISKDPAISGSNFLGRSSGSSRRAAVSSSRDVVASDTYEPSRSRTTDASPGA
FRRTSGPQRSPPVDSAEPKRSSSARHSSNTKNYESALKGIEGLNFEGDERV
Download sequence
Identical sequences I1HQU4
15368.BRADI2G47850.1 EG:BRADI2G47850.1 XP_010232213.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]