SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G48657.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G48657.2
Domain Number 1 Region: 470-777
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.78e-51
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 38-87,140-250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000807
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G48657.2   Gene: BRADI2G48657   Transcript: BRADI2G48657.2
Sequence length 781
Comment pep:novel chromosome:Brachy1.0:2:48904724:48911367:1 gene:BRADI2G48657 transcript:BRADI2G48657.2
Sequence
MEGSRGAGGGGGGGGARPWGGGEEGDGGGRRGEEEGEVSLREWLDRPGRTVEAPECLHVF
RQVTEAVAVAHAQGVAVGSARPSCFVVSPPFSRVAFIESASGSDASGSDASDEAEPDAEP
PRRVDGAGRGEERCFRGFPLKSVLAMELNWYTSPEEADDNGGATFASDVYRLGVLLFELF
CAFETLEEKMRAMANLRYRVLPPQLLLKWPKEASFCQLLMHPVPDTRPKMSEVLQSDFLN
QSRNSLEEHEAALRLREEIEEQDLLLDFLLQLQKRKQDIADNLQDTVAFLSSDINEVVHQ
QSALGQCGNFSFELDKEVSSGTVEDQSDCGSRKRFRPELHAVEMEECNPSLEECSRTVPS
SVLIQESVLSKSSRLLKNFKKLEAAYFLTRSKFASQVCNPISSCDQVIKRTTGSAVGTEG
SSIDDFALEGHYRRRQRGWMNSFLEGLCRYLSFSKLKVRAELKQCDLLNSSNLVCSVGFD
RDNEFFATAGVNKKIKVFEYNMLVNEHRDIHYPVVEMSNRSKLSCICWNSYMKSHIASSD
FEGLVQVWDVTRSQVFVEMREHERRVWSVDFSLADPTKLVSGSDDGSVKLWSMNQAGSVG
TIRTRANVCSVQFQPDSARSIAIGSADHKIYCYDLRNIRAPYSTLVGHTKTVSYVKYVDA
STIVSGSTDNSLKLWDLSMNQSRIIDNPVQTFTGHTNTKNFVGLSISDGYIATGSETNEV
FVYHKAFPMPVLAYKFNVTDPISGQEIDDQSQFISCVCWRGQSSTLLSANSSGNIKVLEM
E
Download sequence
Identical sequences I1HR44
EG:BRADI2G48657.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]