SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G48657.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G48657.3
Domain Number 1 Region: 470-595
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.38e-22
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 38-87,140-250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000481
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G48657.3   Gene: BRADI2G48657   Transcript: BRADI2G48657.3
Sequence length 607
Comment pep:novel chromosome:Brachy1.0:2:48904724:48911367:1 gene:BRADI2G48657 transcript:BRADI2G48657.3
Sequence
MEGSRGAGGGGGGGGARPWGGGEEGDGGGRRGEEEGEVSLREWLDRPGRTVEAPECLHVF
RQVTEAVAVAHAQGVAVGSARPSCFVVSPPFSRVAFIESASGSDASGSDASDEAEPDAEP
PRRVDGAGRGEERCFRGFPLKSVLAMELNWYTSPEEADDNGGATFASDVYRLGVLLFELF
CAFETLEEKMRAMANLRYRVLPPQLLLKWPKEASFCQLLMHPVPDTRPKMSEVLQSDFLN
QSRNSLEEHEAALRLREEIEEQDLLLDFLLQLQKRKQDIADNLQDTVAFLSSDINEVVHQ
QSALGQCGNFSFELDKEVSSGTVEDQSDCGSRKRFRPELHAVEMEECNPSLEECSRTVPS
SVLIQESVLSKSSRLLKNFKKLEAAYFLTRSKFASQVCNPISSCDQVIKRTTGSAVGTEG
SSIDDFALEGHYRRRQRGWMNSFLEGLCRYLSFSKLKVRAELKQCDLLNSSNLVCSVGFD
RDNEFFATAGVNKKIKVFEYNMLVNEHRDIHYPVVEMSNRSKLSCICWNSYMKSHIASSD
FEGLVQVWDVTRSQVFVEMREHERRVWSVDFSLADPTKLVSGSDDGSVKLWSMNQAILFL
HLLYVIF
Download sequence
Identical sequences I1HR45
EG:BRADI2G48657.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]