SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G51842.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G51842.1
Domain Number 1 Region: 528-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-81
Family Protein kinases, catalytic subunit 0.0000679
Further Details:      
 
Domain Number 2 Region: 76-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.16e-28
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G51842.1
Domain Number - Region: 352-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00106
Family Pan module (APPLE domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G51842.1   Gene: BRADI2G51842   Transcript: BRADI2G51842.1
Sequence length 853
Comment pep:novel chromosome:Brachy1.0:2:51415593:51418792:-1 gene:BRADI2G51842 transcript:BRADI2G51842.1
Sequence
MRAAAAPSLILLLLATTFFSVSIATDTIDQTTSITGNSTLISARGIFRLGFFSPPGSPDG
RTYLGIWYAAIPIQNIVWVANRQNPILTSPGVLKLSPDGRLLILDGQNTTVWSSAAPTRN
ITTNNGAATARLFDTGNLVVSSDDGSGSPPSVAWQSFDYPTDTLLPGMKLGVDTKNGITR
NMTSWSSPTDPSPGNYTFKLVTGGLPEFFLFKGPAKIYASGPWNGAGLTGVPYLKAQDFT
FTVVSNPEETYYAYYISDPLVRSRFVVDGTLGQLQRYVWSEGGWSSFWYYPNDACDSYGK
CGPFGSGYCDTGQSPQCSCLPGFTPRSPQQWILKVSSGGCVLKTNLSCGAGDGFWKVNQM
KLPDATNATVHADMTLDDCREACLRNCSCRAYAAANVGGPVSRGCVIWAGDLLDMRQFPE
VVQDVYIRLAQSEVDALNAAQAMRARRRMVIAIATTISSVLLLGAFGYFCFWRNKARRKH
ARQPETALLHFRQTNVLPYKASRKHPDLSPSQDQRFGENRMGGEEDLDLPLFNLAVILVA
TDNFAAEHKIGEGGFGAVYLGRLEDGQEVAVKRLSRKSAQGVEEFKNEVKLIAKLQHKNL
VRLLGCCIDKDERMLVYEFMHNNSLDTFIFDEGKRKLLRWNKRFEIILGIARGLLYLHED
SRFRIIHRDMKASNVLLDRNMIPKISDFGIARMFGGDQTTAYTLKVIGTYGYMSPEYAMD
GVFSMKSDIYSFGIMVLEIVTGKKNRGFHDVKLDLNLLGYAWMLWKEGRSAELLDEAMMI
GDSCDHSQVRRCIQVGLLCVDVQPRNRPLMSSVVMMLAGENATLPEPNEPGVNIGRNTSD
TESSQTQSATDTP
Download sequence
Identical sequences I1HSA3
XP_003567183.1.954 EG:BRADI2G51842.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]